KEGG   Homo sapiens (human): 260425Help
Entry
260425            CDS       T01001                                 

Gene name
MAGI3, MAGI-3, dJ730K3.2
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 3
  KO
K06112  
membrane-associated guanylate kinase-related
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    260425 (MAGI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5TCQ9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.2
AA seq 1481 aa AA seqDB search
MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDAESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDETLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQVEIGSSKPDMEKSHFTRDPSQLKGVLVRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQ
NGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFISTQNGSPRLNRAEV
PARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRP
MGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPLPPSSHFASIF
EESHVPVIEESLRVQICEKAEELKDIVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSH
GHSNKKNLLKVENGVTRRGRSVSPKKPASQHSEEHLDKIPSPLKNNPKRRPRDQSLSPSK
GENKSCQVSTRAGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAEAKLLEGKSRRIAGYT
GSNAEQIPDGKEKSDVIRKDAKQNQLEKSRTRSPEKKIKRMVEKSLPSKMTNKTTSKEVS
ENEKGKKVTTGETSSSNDKIGENVQLSEKRLKQEPEEKVVSNKTEDHKGKELEAADKNKE
TGRFKPESSSPVKKTLITPGPWKVPSGNKVTGTIGMAEKRQ
NT seq 4446 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacgctgaagaagaagaagcactggctcagcaaggtgcaggagtgcgccgtg
tcctgggccgggcccccgggcgacttcggcgcggagatccgcggtggcgcggagcgtggc
gagttcccctacctggggcggctccgcgaggagcccggcgggggcacctgctgcgtcgtc
tcgggcaaggcgcccagcccaggcgatgtgctgctggaggtaaacgggacgcctgtcagc
gggctcaccaaccgggacaccctggctgtcatccgccacttccgcgagcccatccgtctc
aagactgtgaaaccaggcaaagtcattaataaagatttgcggcattacctaagtcttcag
tttcaaaaaggatcaattgaccacaaactgcagcaagtgatcagagataatctctacttg
agaaccattccatgcactacaagggcccccagggatggagaagtaccaggagtggattat
aatttcatttccgttgaacagttcaaagcactggaagagagtggagcattgttagaaagt
gggacatatgatggaaacttctatggaactcccaagcctccagcagaacccagccctttt
cagccagatccagttgatcaagtcctctttgataatgagtttgatgcagaatctcaaaga
aaacgaacgacatctgtcagcaagatggaaagaatggatagctctcttcctgaagaggaa
gaagatgaggacaaggaagctattaatggcagtggaaacgcagaaaacagagagaggcat
tctgagtcatctgactggatgaagactgttccaagttacaaccaaacaaatagctccatg
gactttagaaattatatgatgagagatgagactctggaaccactgcccaaaaactgggaa
atggcctacactgacacagggatgatctacttcattgaccacaataccaagacaaccacc
tggttggatcctcgtctttgtaagaaagccaaagcccctgaagactgtgaagatggagag
cttccttatggctgggagaaaatagaggaccctcagtatgggacatactatgttgatcac
cttaaccagaaaacccagtttgaaaatccagtggaggaagccaaaaggaaaaagcagtta
ggacaggttgaaattgggtcttcaaaaccagatatggaaaaatcacacttcacaagagat
ccatcccagcttaaaggtgtccttgttcgagcatcactgaaaaaaagcacaatgggattt
ggttttactattattggtggagatagacctgatgagttcctacaagtgaaaaatgtgctg
aaagatggtcccgcagctcaggatgggaaaattgcaccaggcgatgttattgtagacatc
aatggcaactgtgtcctcggtcacactcatgcagatgttgtccagatgtttcaattggta
cctgtcaatcagtatgtaaacctcactttatgtcgtggttatccacttcctgatgacagt
gaagatcctgttgtggacattgttgctgctacccctgtcatcaatggacagtcattaacc
aagggagagacttgcatgaatcctcaggattttaagccaggagcaatggttctggagcag
aatggaaaatcgggacacactttgactggtgatggtctcaatggaccatcagatgcaagt
gagcagagagtatccatggcatcgtcaggcagctcccagcctgaactagtgactatccct
ttgattaagggccctaaagggtttgggtttgcaattgctgacagccctactggacagaag
gtgaaaatgatactggatagtcagtggtgtcaaggccttcagaaaggagatataattaag
gaaatataccatcaaaatgtgcagaatttaacacatctccaagtggtagaggtgctaaag
cagtttccagtaggtgctgatgtaccattgcttatcttaagaggaggtcctccttcacca
accaaaactgccaaaatgaaaacagataaaaaggaaaatgcaggaagtttggaggccata
aatgagcctattcctcagcctatgccttttccaccgagcattatcaggtcaggatcccca
aaattggatccttctgaggtctacctgaaatctaagactttatatgaagataaaccacca
aacaccaaagatttggatgtttttcttcgaaaacaagagtcagggtttggcttcagggtg
ctaggaggagatggacctgaccagtctatatatattggggctattattcccctgggagca
gctgagaaagatggtcggctccgcgcagctgatgaactaatgtgcattgatggaattcct
gttaaagggaaatcacacaaacaagtcttggacctcatgacaactgctgctcgaaatggc
catgtgttactaactgtcagacggaagatcttctatggagaaaaacaacccgaggacgac
agctctcaggccttcatttcaacacagaatggatctccccgcctgaaccgggcagaggtc
ccagccaggcctgcaccccaggagccctatgatgttgtcttgcaacgaaaagaaaatgaa
ggatttggctttgtcatcctcacctccaaaaacaaaccacctccaggagttattcctcat
aaaattggccgagtcatagaaggaagtccggctgaccgctgtggaaaactgaaagttgga
gatcatatctctgcagtgaatgggcagtccattgttgaactgtctcatgataacattgtt
cagctgatcaaagatgctggtgtcaccgtcacactaacggtcattgctgaagaagagcat
catggtccaccatcaggaacaaactcagccaggcaaagcccagccctgcagcacaggccc
atgggacagtcacaggccaaccacatacctggggacagaagtgccctagaaggtgaaatt
ggaaaagatgtctccacttcttacagacattcttggtcagaccacaagcaccttgcacag
cctgacaccgcagtaatttcagttgtaggcagtcggcacaatcagaaccttggttgttat
ccagtagagctggagagaggcccccggggctttggattcagcctccgaggggggaaggag
tacaacatggggctgttcatccttcgtcttgctgaagatggtcctgccatcaaagatggc
agaattcatgttggtgaccagattgttgaaatcaatggggaacctacacaaggaatcaca
catactcgagcaattgagctcattcaggctggtggaaataaagttcttcttcttttgagg
ccaggaactggcttgatacctgaccatggtgattgggatattaataatccttcgtcttca
aatgtgatttatgatgaacagtcaccattacccccatcttcacattttgcttccatattt
gaagagtctcacgtgccagtaattgaagaatctttgagagttcagatatgtgaaaaggca
gaagaattaaaggacattgtgcctgaaaagaaaagcactttaaatgaaaatcagcctgag
ataaagcatcagtctcttctccagaaaaatgtgagtaagagggatccacccagcagtcat
gggcacagtaacaagaaaaatctattaaaagtagaaaatggtgttacacgaagaggtaga
tcggttagtcccaaaaagccagccagtcaacattcagaggaacatttggataagattcct
agtcctctaaaaaataaccccaaaagaagacccagagatcaatccctcagccccagcaaa
ggggaaaataaaagttgtcaggtcagcaccagggcaggctctggacaagatcagtgcaga
aaaagcagaggtcggtcggccagcccaaaaaagcagcaaaaaattgaaggaagcaaagct
ccatcaaatgctgaggccaaattattagagggtaagagtcgaagaatagcaggctatacg
ggcagtaatgctgagcagatcccagatgggaaggaaaaatcagacgtcatcaggaaagat
gcaaagcagaatcagttggaaaaaagcagaacaaggtctccagagaaaaaaatcaaaaga
atggttgagaaatctcttccatccaaaatgactaataagactacaagtaaagaagtatct
gaaaatgaaaaaggaaagaaagtaaccacaggagaaacaagttctagtaacgataaaata
ggagaaaatgtccagctatcagaaaagaggctgaagcaagaacctgaagagaaggtagtt
tcaaacaaaacagaagatcacaaagggaaagaactagaggcagctgacaaaaacaaagag
actggaaggttcaaaccggaaagcagttctccagttaagaaaacactgataactccaggg
ccctggaaggttccaagtggaaataaagtcacaggcactattggtatggctgagaaacgg
cagtaa

DBGET integrated database retrieval system