KEGG   Homo sapiens (human): 26047Help
Entry
26047             CDS       T01001                                 

Gene name
CNTNAP2, AUTS15, CASPR2, CDFE, NRXN4, PTHSL1
Definition
(RefSeq) contactin associated protein-like 2
  KO
K07380  
contactin associated protein-like 2
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00756  
Pitt-Hopkins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    26047 (CNTNAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 1331 aa AA seqDB search
MQAAPRAGCGAALLLWIVSSCLCRAWTAPSTSQKCDEPLVSGLPHVAFSSSSSISGSYSP
GYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDT
GRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPIIARYVRIVPLDWNGEGRIGLRIEVYG
CSYWADVINFDGHVVLPYRFRNKKMKTLKDVIALNFKTSESEGVILHGEGQQGDYITLEL
KKAKLVLSLNLGSNQLGPIYGHTSVMTGSLLDDHHWHSVVIERQGRSINLTLDRSMQHFR
TNGEFDYLDLDYEITFGGIPFSGKPSSSSRKNFKGCMESINYNGVNITDLARRKKLEPSN
VGNLSFSCVEPYTVPVFFNATSYLEVPGRLNQDLFSVSFQFRTWNPNGLLVFSHFADNLG
NVEIDLTESKVGVHINITQTKMSQIDISSGSGLNDGQWHEVRFLAKENFAILTIDGDEAS
AVRTNSPLQVKTGEKYFFGGFLNQMNNSSHSVLQPSFQGCMQLIQVDDQLVNLYEVAQRK
PGSFANVSIDMCAIIDRCVPNHCEHGGKCSQTWDSFKCTCDETGYSGATCHNSIYEPSCE
AYKHLGQTSNYYWIDPDGSGPLGPLKVYCNMTEDKVWTIVSHDLQMQTPVVGYNPEKYSV
TQLVYSASMDQISAITDSAEYCEQYVSYFCKMSRLLNTPDGSPYTWWVGKANEKHYYWGG
SGPGIQKCACGIERNCTDPKYYCNCDADYKQWRKDAGFLSYKDHLPVSQVVVGDTDRQGS
EAKLSVGPLRCQGDRNYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLTPWGVFLENM
GKEDFIKLELKSATEVSFSFDVGNGPVEIVVRSPTPLNDDQWHRVTAERNVKQASLQVDR
LPQQIRKAPTEGHTRLELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFI
SGCSGHCTSYGTNCENGGKCLERYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQ
APATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVK
PTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPS
SSDTLFNSPKSLFLGKVIETGKIDQEIHKYNTPGFTGCLSRVQFNQIAPLKAALRQTNAS
AHVHIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRN
SAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTE
TIDESKKEWLI
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggctccgcgcgccggctgcggggcagcgctcctgctgtggattgtcagcagc
tgcctctgcagagcctggacggctccctccacgtcccaaaaatgtgatgagccacttgtc
tctggactcccccatgtggctttcagcagctcctcctccatctctggtagctattctccc
ggctatgccaagataaacaagagaggaggtgctgggggatggtctccatcagacagcgac
cattatcaatggcttcaggttgactttggcaatcggaagcagatcagtgccattgcaacc
caaggaaggtatagcagctcagattgggtgacccaataccggatgctctacagcgacaca
gggagaaactggaaaccctatcatcaagatgggaatatctgggcatttcccggaaacatt
aactctgacggtgtggtccggcacgaattacagcatccgattattgcccgctatgtgcgc
atagtgcctctggattggaatggagaaggtcgcattggactcagaattgaagtttatggc
tgttcttactgggctgatgttatcaactttgatggccatgttgtattaccatatagattc
agaaacaagaagatgaaaacactgaaagatgtcattgccttgaactttaagacgtctgaa
agtgaaggagtaatcctgcacggagaaggacagcaaggagattacattaccttggaactg
aaaaaagccaagctggtcctcagtttaaacttaggaagcaaccagcttggccccatatat
ggccacacatcagtgatgacaggaagtttgctggatgaccaccactggcactctgtggtc
attgagcgccaggggcggagcattaacctcactctggacaggagcatgcagcacttccgt
accaatggagagtttgactacctggacttggactatgagataacctttggaggcatccct
ttctctggcaagcccagctccagcagtagaaagaatttcaaaggctgcatggaaagcatc
aactacaatggcgtcaacattactgatcttgccagaaggaagaaattagagccctcaaat
gtgggaaatttgagcttttcttgtgtggaaccctatacggtgcctgtctttttcaacgct
acaagttacctggaggtgcccggacggcttaaccaggacctgttctcagtcagtttccag
tttaggacatggaaccccaatggtctcctggtcttcagtcactttgcggataatttgggc
aatgtggagattgacctcactgaaagcaaagtgggtgttcacatcaacatcacacagacc
aagatgagccaaatcgatatttcctcaggttctgggttgaatgatggacagtggcacgag
gttcgcttcctagccaaggaaaattttgctattctcaccatcgatggagatgaagcatca
gcagttcgaactaatagtccccttcaagttaaaactggcgagaagtacttttttggaggt
tttctgaaccagatgaataactcaagtcactctgtccttcagccttcattccaaggatgc
atgcagctcattcaagtggacgatcaacttgtaaatttatacgaagtggcacaaaggaag
ccgggaagtttcgcgaatgtcagcattgacatgtgtgcgatcatagacagatgtgtgccc
aatcactgtgagcatggtggaaagtgctcgcaaacatgggacagcttcaaatgcacttgt
gatgagacaggatacagtggggccacctgccacaactctatctacgagccttcctgtgaa
gcctacaaacacctaggacagacatcaaattattactggatagatcctgatggcagcgga
cctctggggcctctgaaagtttactgcaacatgacagaggacaaagtgtggaccatagtg
tctcatgacttgcagatgcagacgcctgtggtcggctacaacccagaaaaatactcagtg
acacagctcgtttacagcgcctccatggaccagataagtgccatcactgacagtgccgag
tactgcgagcagtatgtctcctatttctgcaagatgtcaagattgttgaacaccccagat
ggaagcccttacacttggtgggttggcaaagccaacgagaagcactactactggggaggc
tctgggcctggaatccagaaatgtgcctgcggcatcgaacgcaactgcacagatcccaag
tactactgtaactgcgacgcggactacaagcaatggaggaaggatgctggtttcttatca
tacaaagatcacctgccagtgagccaagtggtggttggagatactgaccgtcaaggctca
gaagccaaattgagcgtaggtcctctgcgctgccaaggagacaggaattattggaatgcc
gcctctttcccaaacccatcctcctacctgcacttctctactttccaaggggaaactagc
gctgacatttctttctacttcaaaacattaaccccctggggagtgtttcttgaaaatatg
ggaaaggaagatttcatcaagctggagctgaagtctgccacagaagtgtccttttcattt
gatgtgggaaatgggccagtagagattgtagtgaggtcaccaacccctctcaacgatgac
cagtggcaccgggtcactgcagagaggaatgtcaagcaggccagcctacaggtggaccgg
ctaccgcagcagatccgcaaggccccaacagaaggccacacccgcctggagctctacagc
cagttatttgtgggtggtgctgggggccagcagggcttcctgggctgcatccgctccttg
aggatgaatggggtgacacttgacctggaggaaagagcaaaggtcacatctgggttcata
tccggatgctcgggccattgcaccagctatggaacaaactgtgaaaatggaggcaaatgc
ctagagagataccacggttactcctgcgattgctctaatactgcatatgatggaacattt
tgcaacaaagatgttggtgcattttttgaagaagggatgtggctacgatataactttcag
gcaccagcaacaaatgccagagactccagcagcagagtagacaacgctcccgaccagcag
aactcccacccggacctggcacaggaggagatccgcttcagcttcagcaccaccaaggcg
ccctgcattctcctctacatcagctccttcaccacagacttcttggcagtcctcgtcaaa
cccactggaagcttacagattcgatacaacctgggtggcacccgagagccatacaatatt
gacgtagaccacaggaacatggccaatggacagccccacagtgtcaacatcacccgccac
gagaagaccatctttctcaagctcgatcattatccttctgtgagttaccatctgccaagt
tcatccgacaccctcttcaattctcccaagtcgctctttctgggaaaagttatagaaaca
gggaaaattgaccaagagattcacaaatacaacaccccaggattcactggttgcctctcc
agagtccagttcaaccagatcgcccctctcaaggccgccttgaggcagacaaacgcctcg
gctcacgtccacatccagggcgagctggtggagtccaactgcggggcctcgccgctgacc
ctctcccccatgtcgtccgccaccgacccctggcacctggatcacctggattcagccagt
gcggattttccatataatccaggacaaggccaagctataagaaatggagtcaacagaaac
tcggctatcattggaggcgtcattgctgtggtgattttcaccatcctgtgcaccctggtc
ttcctgatccggtacatgttccgccacaagggcacctaccataccaacgaagcaaagggg
gcggagtcggcagagagcgcggacgccgccatcatgaacaacgaccccaacttcacagag
accattgatgaaagcaaaaaggaatggctcatttga

DBGET integrated database retrieval system