KEGG   Homo sapiens (human): 26052Help
Entry
26052             CDS       T01001                                 

Gene name
DNM3, Dyna_III
Definition
dynamin 3 (EC:3.6.5.5)
Orthology
K01528  
dynamin GTPase [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Bacterial invasion of epithelial cells
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q24.3
AA seq 859 aa AA seqDB search
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQVIRKGWLTISNIGIMKGGSKGYWFV
LTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQRNVYKDYRFLE
LACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYM
SIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLR
MYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPT
SGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTRAPPSVPSRRP
PPSPTRPTIIRPLESSLLD
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccgggagatggaggagctgatcccgctggtgaaccgtctgcaggacgcgttt
tcggcgctgggacagagctgcctgctggagctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaacttcgtgggcagggactttctccctcgaggg
tcgggcattgtaacaagacgacctcttgtgctgcagcttgttacttctaaagcagaatat
gccgagtttctacattgcaaaggaaagaaatttacagattttgatgaagttcgccttgag
attgaagcagaaacagatcgcgtgactggaatgaataaaggcatttcctccatacccatt
aatttacgagtctattccccacacgtgttaaatctaacccttattgatctacctggaata
actaaagtgcctgtgggagatcagccaccagatatcgagtatcagatcagagaaatgatt
atgcagttcatcacgagggagaactgtctgattttagctgttactccagccaacactgat
cttgcaaactcagatgcgctgaagctagctaaagaagttgatcctcaaggtctgagaacc
attggagttatcaccaaactggaccttatggatgaaggaacggatgccagggatgttcta
gagaacaaactgttgcctcttcgcaggggttacgtgggggtggtaaacagaagccagaag
gacatagatgggaagaaggacataaaggcagccatgctggcagagaggaagtttttcctt
tcccacccggcttacagacatatcgctgaccgaatgggaaccccacacctgcagaaggtc
cttaatcagcaacttaccaaccacattcgggataccctaccaaacttcaggaacaaacta
cagggacagttgctctccatagaacatgaagtagaagcctacaaaaatttcaaaccagaa
gacccaacaaggaagaccaaagcattgctgcagatggttcagcaatttgctgtggacttt
gagaagagaattgaagggtcaggggatcaagtagataccctggaactctcaggtggtgct
aaaatcaatcgtatttttcatgaacgctttccttttgagatagtaaagatggagttcaat
gagaaagaattgcgaagagaaataagctatgcaatcaaaaacatacatggtatcaggaca
gggttgtttactccagacatggcatttgaagcgatagtcaagaaacagattgtaaagttg
aaagggccttccttgaagagtgtggatctggtaatacaagaattaatcaacactgtgaag
aagtgtaccaaaaaactggcaaacttccccagactctgcgaggaaacggaaaggattgtt
gctaaccacattcgtgagcgagaagggaagacaaaggaccaggtattgctattgattgac
attcaagtctcttacatcaacaccaaccatgaagacttcattggcttcgcaaatgctcag
cagaggagcagtcaggttcacaagaaaaccacagttggaaatcaggtgattcgcaagggg
tggctcaccatcagcaacattggcatcatgaaaggcggctcgaagggatactggttcgtc
cttactgcggaaagcttgtcctggtataaagatgatgaggaaaaagaaaagaagtacatg
cttcccttggacaacctgaaagttcgggatgtggaaaagagctttatgtctagcaagcac
atctttgcactctttaatacagagcaaaggaatgtatacaaagactatcgcttccttgag
ctggcatgtgattcccaggaggatgtcgacagctggaaggcatctctactaagagctggg
gtctatcctgacaaatctgtagctgaaaatgatgagaatggacaagcagaaaacttttcc
atggacccacaattggagaggcaagtggagaccattcgcaacctcgtagactcctacatg
tccattatcaacaaatgtatccgagatctaattccaaaaacaataatgcaccttatgatc
aataacgttaaagatttcataaattccgagctcctagcacagttgtattcttcagaggac
caaaataccctgatggaggaatctgctgagcaggctcagcgccgggatgagatgcttcga
atgtatcaagcactgaaagaagcccttgggataattggggacatcagcacagccaccgtg
tccactccggcaccccctccagtggatgactcctggatacagcactctcgcaggtcacct
cctccaagccccacaacccaaaggaggccaacactaagtgctcccctcgcaaggcccaca
tccggccgaggaccagctcctgccattccctctcctggcccccactctggggctcctcca
gtcccattccgtccaggcccattacctcctttccccagcagcagtgactccttcggagcc
cctccacaagttccatctaggcctacgagggccccgcccagtgtcccaagccggagacca
cccccatcaccaactcgtcccactataatccgcccactagaatcctccctgttagactaa

DBGET integrated database retrieval system