KEGG   Homo sapiens (human): 26057Help
Entry
26057             CDS       T01001                                 

Gene name
ANKRD17, GTAR, MASK2, NY-BR-16
Definition
(RefSeq) ankyrin repeat domain 17
  KO
K16726  
ankyrin repeat domain-containing protein 17
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     26057 (ANKRD17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.3
AA seq 2603 aa AA seqDB search
MEKATVPVAAATAAEGEGSPPAVAAVAGPPAAAEVGGGVGGSSRARSASSPRGMVRVCDL
LLKKKPPQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGGGTSSNNSEEEE
DDDDEEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEALLE
AAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNRSLAE
ACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKG
DITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASI
EDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFL
LEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHV
ELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTL
ACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTA
LTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGANVNRTT
ANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYP
NNLLSAPPPDVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPANVATTLPIRNKAAS
KQKSSSHLPANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLELAHA
DQLTKEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQ
QQQQSCQHLGLLTPVGVGEQLSEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQ
ALPLAAGPLPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLN
DTLDDIMAAVSGRASAMSNTPTHSIAASISQPQTPTPSPIISPSAMLPIYPAIDIDAQTE
SNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGA
DIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIK
ILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLAC
FQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSR
DTALTIAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVD
AADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMES
IVQAKDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLE
EIEAKNKENFELQAAQEKEKLKVEDEPEVLTEPPSATTTTTIGISATWTTLAGSHGKRNN
TITTTSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRIS
SCSDESSNSNSSRKSDNHSPAVVTTTVSSKKQPSVLVTFPKEERKSVSGKASIKLSETIS
EGTSNSLSTCTKSGPSPLSSPNGKLTVASPKRGQKREEGWKEVVRRSKKVSVPSTVISRV
IGRGGCNINAIREFTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIKDPDKEI
DELIPKNRLKSSSANSKIGSSAPTTTAANTSLMGIKMTTVALSSTSQTATALTVPAISSA
STHKTIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTFPPA
QSTWGPFPVRPLSPARATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTTSSSASTV
PGTSTNGSPSSPSVRRQLFVTVVKTSNATTTTVTTTASNNNTAPTNATYPMPTAKEHYPV
SSPSSPSPPAQPGGVSRNSPLDCGSASPNKVASSSEQEAGSPPVVETTNTRPPNSSSSSG
SSSAHSNQQQPPGSVSQEPRPPLQQSQVPPPEVRMTVPPLATSSAPVAVPSTAPVTYPMP
QTPMGCPQPTPKMETPAIRPPPHGTTAPHKNSASVQNSSVAVLSVNHIKRPHSVPSSVQL
PSTLSTQSACQNSVHPANKPIAPNFSAPLPFGPFSTLFENSPTSAHAFWGGSVVSSQSTP
ESMLSGKSSYLPNSDPLHQSDTSKAPGFRPPLQRPAPSPSGIVNMDSPYGSVTPSSTHLG
NFASNISGGQMYGPGAPLGGAPAAANFNRQHFSPLSLLTPCSSASNDSSAQSVSSGVRAP
SPAPSSVPLGSEKPSNVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGHSGIW
SFEGIGGNQDKVDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFHQHVPA
GYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENN
GPQTVWTGPWAPHMNSVHMNQLG
NT seq 7812 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggcgacggttccggtggcggcggcgacggctgcagaaggagaagggagcccc
ccggcggtggcggctgtggcgggcccccccgcggcggcggaggtcggcggcggcgttggc
ggcagcagcagagctcgctcggcctcgtctcctcgtgggatggtgcgagtctgcgacctg
ctcctgaagaagaagccgccgcagcagcagcaccacaaggccaagcgtaaccggacttgc
cgaccccccagcagcagcgaaagcagcagcgacagcgacaacagcggcggcggtggaggc
ggcggtggaggcggaggtggcggcggcggcaccagcagtaacaacagcgaggaagaagag
gacgacgacgacgaggaagaggaggtttctgaggtggagtctttcattttggatcaggat
gatttggaaaatccaatgctggaaacagcttccaagttgctcttatcaggtactgctgat
ggtgcagacctcaggacagtagatccagaaacacaggctagactggaagctttactagaa
gctgcaggaataggaaaattgtccacggctgatggtaaagcctttgcagatcctgaagta
cttcggaggttgacatcgtctgttagttgtgcgttggatgaagctgctgctgcacttacc
cgtatgagagctgaaagcacagcaaatgcagggcagtcggacaaccgcagtttggcagaa
gcctgttcagaaggagatgtaaatgctgtgcgaaagttactcattgaagggcgaagtgta
aatgaacacacagaggaaggggagagcctcctttgtttagcttgttctgctggatactat
gagcttgcacaggttttgttggcaatgcatgcaaatgtggaagataggggaatcaaaggt
gacattacacctttaatggctgctgctaatggaggacatgtcaaaattgtgaagttgctg
ctagctcataaagcagatgttaatgcacagtcttcaacaggcaatacagcacttacatat
gcttgtgctggaggctatgtagatgttgtaaaggtgctcttggaatccggtgctagtatt
gaggaccataatgaaaatggtcatacccctcttatggaagctggaagtgctggacatgtg
gaagtagccagattgctgctagaaaatggggctggcattaatacgcattctaatgaattt
aaagagagtgcccttaccttagcttgttacaaaggacacttagagatggtgcgatttctt
ttggaagcaggcgcggatcaagagcataaaacagatgaaatgcacactgctctgatggag
gcttgcatggatggccatgttgaagtagctaggttacttcttgacagcggtgcccaagtg
aacatgcctgctgattcatttgagtcaccattaactttggctgcatgtggtgggcatgtg
gaacttgcggctttacttattgaaagaggagctagcctggaagaggtcaatgatgaaggt
tatacaccattgatggaagcagctcgagaaggacatgaagaaatggtggcattacttctt
ggtcaaggagcaaatatcaatgcacagacagaagaaactcaagaaactgccttgactctg
gcttgctgtggaggctttctggaagtggcagactttctaattaaggcaggagccgatata
gaactagggtgttctacccctttaatggaagctgctcaagagggtcatttggagttagtt
aaatacttattagctgcaggagctaacgttcatgcaacaacagcaacaggggatacagca
ctaacatatgcctgtgaaaatggtcatactgatgtagcagatgtcttacttcaggcaggc
gcagatctggaacatgaatctgaaggtggaagaactcctttaatgaaagctgcaagagct
ggtcatgtttgtactgttcagttcttaattagtaaaggagcgaatgtgaatagaaccaca
gctaataatgaccatactgtactgtccctggcttgtgcagggggtcatctggcagtggtg
gaactacttttggctcatggggcagatcctactcaccgtttgaaagatggctcaactatg
ttgatagaagcagcaaaaggtggccatacaagtgttgtttgctatctcttggattatcct
aataacttgctttcagcccctccaccagatgtcactcagttaactcccccatcccacgat
ttaaatagggctcctcgtgtaccagttcaagcactgcccatggttgttccacctcaggag
cctgacaaaccacctgccaatgttgccaccactcttcccatcaggaataaagctgcttct
aaacaaaagtccagcagccatttgccagcaaacagccaggatgtacagggttacatcacc
aatcagtctccagagagcattgtagaagaggctcagggaaagttaacagaactggaacag
aggataaaagaagccatagaaaagaatgcacagctgcagtccttggaactggctcatgct
gaccaacttaccaaggagaagatcgaggagctcaacaaaacaagggaggaacaaattcag
aagaaacaaaagattttggaggaactacagaaagtagaacgagagttacaactgaaaact
cagcagcagctaaaaaagcagtatctagaggttaaagctcaaagaattcaacttcagcaa
cagcagcaacagtcttgccaacacctgggattactaactcctgttggagttggagagcag
ctttctgagggagactatgcacggttacagcaagtggatcctgttttacttaaagatgaa
ccccagcagactgctgctcagatgggttttgcgccaatccagcctctggcgatgcctcaa
gctttgcctctggcggcaggtcccttgcctccagggtccatcgcaaatcttacagaactg
caaggagtgatagttggacagccagtactgggccaagcacagttggcagggctggggcaa
ggaattctgacagaaacacaacaagggttaatggtagccagccctgctcagaccctcaat
gacacgctggatgacatcatggcagcagtcagtggaagagcatctgcaatgtcaaacact
cctacccacagtattgctgcatccatttcccaacctcagactccaactccaagtcctatc
atctctccttcagccatgcttcctatctaccctgccattgatattgatgcacagactgag
agtaatcatgacacggcgctaacacttgcctgtgctggtggccacgaggaactggtacaa
acactgctagagagaggagctagtatagagcaccgagacaagaaaggttttactccactc
atcttggctgccacagctggtcatgttggtgttgtggaaatattgctggacaatggtgca
gacattgaagcccagtctgaaagaaccaaggacacaccactctccttggcttgttctggg
ggaagacaggaggtggtggagctattgttagctcgaggggcaaataaagagcacaggaat
gtttctgattacacacctctaagtctggctgcttctggtggctatgtgaacatcatcaaa
atattactaaatgcaggagctgagattaactctagaactggtagcaaattgggcatctct
cctctgatgttagcagctatgaatgggcatacagctgctgttaagctcctgttagacatg
ggctctgacataaatgctcagatagaaaccaatcggaacactgcccttactttagcctgc
ttccaaggaagaactgaagtggttagtcttctgcttgatagaaaagcaaatgttgaacac
agagctaagactggtctcacaccactaatggaagctgcctctggtggatatgcggaggtg
ggccgagttcttttggataaaggtgctgatgttaatgcccctccagttccctcctcaaga
gatacagctttaaccatagcagcagataaagggcattacaaattctgtgagcttcttatt
ggcaggggagctcatattgatgtacgtaacaagaaggggaacactccattgtggctagca
gcaaatggtggacacctcgatgtggttcagttactggtgcaagcaggtgcagatgtggat
gcagcagataaccgcaagataactcctcttatggcagcatttagaaagggtcatgtgaag
gtggtgcgctacttagtcaaagaagtcaatcagtttccatcagattctgaatgtatgaga
tacatagcaaccatcactgataaggagatgctgaagaagtgtcatctttgtatggagtca
atagtacaagccaaagatagacaggctgctgaagcaaacaaaaacgccagcattttgtta
gaggagttagacttggaaaagttaagggaagaaagtcggaggctggctttggctgcgaaa
agagaaaaaagaaaagagaagagaaggaagaaaaaggaagaacaaagaaggaaactagaa
gaaattgaagccaaaaataaagagaactttgaactccaagctgctcaagaaaaagaaaag
cttaaagttgaagatgagcctgaagtcttgacagaacctccaagtgccacaaccactact
accataggtatatctgcaacctggacaactttggcaggttctcatggtaaaagaaataat
accataactacaaccagttcaaagaggaaaaacaggaaaaataaaattactccagaaaac
gttcaaattatatttgatgatccactaccaatttcatacagtcagccagagaaggtgaat
ggagagtccaagagcagcagtaccagcgagagtggggacagtgataacatgaggatttcc
agctgcagcgatgaaagtagtaacagcaacagcagtcgtaagagtgacaatcattcacca
gctgtggtcactaccactgtgagcagcaaaaagcagccatcagttcttgttacatttcca
aaggaagagagaaaatctgtttctggcaaggcttcaataaaattgtcagaaactatcagt
gaagggaccagtaattctctatctacttgtacaaaatctggtccatctcccctttcttct
ccaaatgggaagttaacagtagcaagtcctaagcgtgggcaaaagagggaagaaggatgg
aaagaagttgtaagaaggtcaaagaaagtatctgttccatcaactgtgatatccagagtg
attggaagaggaggctgtaatatcaatgctattcgggagtttactggtgcacacatagat
attgataaacagaaagacaagactggagaccggataatcactataaggggtggcactgaa
tcaacaagacaagcaactcaattgattaatgctttgatcaaggatccagacaaagaaatt
gatgaacttattccaaagaatcgtttgaaaagctcctcagcaaattccaaaatagggtca
tcagcacctaccaccactgctgctaacacttccttaatgggaattaaaatgacaactgta
gctctgtcatcaacatctcaaactgccacagcactcactgtgcctgcaatttcttctgca
tccactcacaaaaccattaagaacccagtgaataatgtgaggcctggttttccagtttct
cttccattagcatatcctcctccacagtttgcacatgctttgcttgctgctcagactttc
cagcagatccgtccaccaaggttgcccatgacccactttggaggtacttttccaccagct
caatccacttggggtccgtttcctgtcaggcctttgagccctgccagagctactaactcg
cctaagcctcacatggtgcctcgccatagcaatcagaatagcagtggttctcaggtgaat
tcagcaggttctttaacttcaagcccaacaactacaaccagttcatcagcttcaacggtg
cctggtacatctacaaatggcagtccaagttcaccttctgtccgaaggcagctttttgtc
acagttgtgaagacatccaatgccaccacaacaacagtcacaaccacggcaagcaacaac
aacactgcacccacaaatgccacatatcctatgcctactgccaaagaacactatccagta
tcatccccatcttccccatcaccaccagcccagccaggaggggtttctagaaacagccct
ttggattgtggatcagcatctccaaataaagtggcatcttcctccgaacaggaagcaggt
agtccaccagtagtagaaacaacaaacactagacctccaaacagcagcagttcttctggg
agttcatcagctcattctaatcagcaacaacctccgggatctgtttctcaggaaccaaga
ccacctcttcagcagtctcaggttcctcccccggaagttagaatgactgttcctccttta
gcaacaagttctgctccagtggcggtgccttctactgccccagtgacttaccctatgcct
cagacaccaatgggatgcccccagcctactcctaaaatggaaacccctgctattagacca
ccccctcatggcacaactgcccctcacaagaattcagcttcagtgcaaaattcatctgtt
gcagtcctcagtgtcaatcacattaaaagacctcacagtgttccctcttctgtccagcta
ccttcgaccttaagtacacaaagtgcttgtcagaattcagtacatccagcaaataagcct
attgctcccaatttcagtgcccccttaccatttgggccctttagcacattgtttgaaaac
agccctacttctgctcatgccttctggggaggatctgttgtttcatctcagtcaacacca
gaatctatgctatcaggaaaatcctcatatttgccaaattcagatcctttacatcagtct
gatacttccaaagctccaggttttagaccaccattacagagacctgctccaagtccctca
ggtattgtcaatatggactcgccatatggttctgtaacaccttcttcaacacatttggga
aactttgcttcaaacatttcaggaggtcagatgtacggacctggggcaccccttggagga
gcacccgcagctgctaactttaacagacaacatttttccccgcttagtttgttgactccg
tgttcatcagcatcaaatgattcttctgcacagtcagtatcctcgggagttcgtgcacca
tctcctgccccatcatcagtaccgttagggtcagaaaagcccagcaatgtgtctcaggac
aggaaagttccagtccctattgggactgaacgttctgcacgtatcaggcaaactggaacg
tcagctccatctgttattgggagcaatttgtctacatcagtaggacatagtggcatctgg
tcctttgaagggattggtggcaatcaagacaaagtagactggtgtaaccctgggatggga
aatcctatgatccacagaccgatgtctgacccaggagtattttcacaacatcaagcaatg
gagcgagatagtacaggaattgtaactccttctggtacattccatcagcatgttcctgca
ggctacatggactttcctaaagttgggggtatgcctttttctgtgtatgggaatgcaatg
attcctccagtagcacctatccctgatggtgctggaggacccatatttaatggccctcat
gctgcagacccttcttggaactcactgataaagatggtttccagctccacggaaaataat
ggccctcaaacggtgtggactggaccctgggcacctcacatgaacagtgtgcatatgaac
cagcttggctga

DBGET integrated database retrieval system