KEGG   Homo sapiens (human): 26061Help
Entry
26061             CDS       T01001                                 

Gene name
HACL1, 2-HPCL, HPCL, HPCL2, PHYH2
Definition
2-hydroxyacyl-CoA lyase 1
Orthology
K12261  
2-hydroxyacyl-CoA lyase 1 [EC:4.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Class
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25.1
AA seq 551 aa AA seqDB search
MPDSNFAERSEEQVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNE
QAACYAASAIGYLTSRPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAI
PFVIEKAVRSSIYGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAA
SVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVVPDNHPYCVGAARS
RALQFADVIVLFGARLNWILHFGLPPRYQPDVKFIQVDICAEELGNNVKPAVTLLGNIHA
VTKQLLEELDKTPWQYPPESKWWKTLREKMKSNEAASKELASKKSLPMNYYTVFYHVQEQ
LPRDCFVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTMGVGLGFAIAAAVVAKDRSPGQ
WIICVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVV
PPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSLADTTKPSLINIMIEPQATRKA
QDFHWLTRSNM
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgccggacagtaacttcgcagagcgcagcgaggagcaggtgtctggtgctaaagtcatc
gctcaggccctgaaaacgcaagatgtggagtacatatttggcatcgtaggcatcccagtg
accgaaatcgccattgctgcccagcagctaggcatcaagtacatcgggatgaggaatgag
caagcggcttgttatgctgcctccgcgattggatatctgacaagcaggcccttgcttgtg
attggtggttcctctgaaagaaaccaagaaacaatgggagctttccaggagtttcctcag
gttgaagcttgtagattatataccaagttctctgcccgcccaagcagcatagaagctatt
ccttttgttattgaaaaggcagtgagaagcagtatctatggtcgtccaggtgcttgctat
gttgacataccagcagattttgtgaaccttcaggtgaatgtgaattctataaagtacatg
gaacgctgcatgtcacctcctattagcatggcagaaacctctgctgtgtgcacggcggct
tctgttattaggaatgccaaacaaccccttcttatcatcgggaaaggtgctgcttacgct
catgcagaagagagtatcaagaaattggtggagcaatataaactgccatttttgcccacc
cctatggggaagggtgttgtccctgacaaccatccatactgtgtaggtgcagccagatcc
agggctttgcaatttgctgatgtaattgtgttatttggtgccagactaaattggatttta
cattttggactgcctccaagatatcagccagatgtgaagtttatccaggttgatatctgt
gcagaagaattggggaataatgtaaagcccgctgttactttgctaggaaacatacatgct
gtcactaagcagcttttagaggaacttgataaaacaccatggcagtatcctccagagagc
aagtggtggaaaactctgagagaaaaaatgaagagcaatgaagctgcatccaaggaacta
gcttctaaaaaatccctgcctatgaattattacacagtattctaccatgttcaagaacaa
ctacctagagactgtttcgtggtaagtgaaggagcaaatactatggacattggacggact
gtgcttcagaactaccttcctcgtcacaggcttgatgctggtactttcggaacaatggga
gttggtttgggatttgctattgcagctgccgtggtggctaaagatagaagccctgggcaa
tggatcatctgtgtggaaggagacagtgcatttgggttttctggcatggaggtagaaacc
atctgcaggtacaacttgccaatcatactgttggtagtgaataacaatggaatttaccaa
ggttttgatacagatacttggaaagaaatgttaaaatttcaagatgctactgcagtggtc
cctccaatgtgtttgctgccaaattcacattatgagcaagtcatgactgcatttggaggc
aaagggtattttgtacaaacaccagaagaactccaaaaatccctgaggcagagcctagca
gacacaactaaaccttctcttatcaacatcatgattgagccacaagccacacggaaggcc
caggattttcattggctgacccgctctaatatgtaa

DBGET integrated database retrieval system