KEGG   Homo sapiens (human): 26064Help
Entry
26064             CDS       T01001                                 

Gene name
RAI14, NORPEG, RAI13
Definition
(RefSeq) retinoic acid induced 14
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.3-p13.2
AA seq 980 aa AA seqDB search
MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLA
AAKGHVECLRVMITHGVDVTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGK
TALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNS
RNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSK
ISQDADLKTPTKPKQHDQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLS
GKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLT
LHNKELQDKLQAKSPKEAEADLSFDSYHSTQTDLGPSLGKPGETSPPDSKSSPSVLIHSL
GKSTTDNDVRIQQLQEILQDLQKRLESSEAERKQLQVELQSRRAELVCLNNTEISENSSD
LSQKLKETQSKYEEAMKEVLSVQKQMKLGLVSPESMDNYSHFHELRVTEEEINVLKQDLQ
NALEESERNKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKAFLFEK
YQEAQEEIMKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEAQAELE
DYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAEDALSEMKSQYSKVLNELTQLKQLV
DAQKENSVSITEHLQVITTLRTAAKEMEEKISNLKEHLASKEVEVAKLEKQLLEEKAAMT
DAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQT
LLKSKEQEVNELLQKFQQAQEELAEMKRYAESSSKLEEDKDKKINEMSKEVTKLKEALNS
LSQLSYSTSSSKRQSQQLEALQQQVKQLQNQLAECKKQHQEVISVYRMHLLYAVQGQMDE
DVQKVLKQILTMCKNQSQKK
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcttgaaagcgaagttcaggaagagtgacaccaatgagtggaacaagaatgat
gaccggctactgcaggccgtggagaatggagatgcggagaaggtggcctcactgctcggc
aagaagggggccagtgccaccaaacacgacagtgagggcaagaccgctttccatcttgct
gctgcaaaaggacacgtggaatgcctcagggtcatgattacacatggtgtggatgtgaca
gcccaagatactaccggacacagcgccttacatctcgcagccaagaacagccaccatgaa
tgcatcaggaagctgcttcagtctaaatgcccagccgaaagtgtcgacagctctgggaaa
acagctttacattatgcagcggctcagggctgccttcaagctgtgcagattctctgcgaa
cacaagagccccataaacctcaaagatttggatgggaatataccgctgcttcttgctgta
caaaatggtcacagtgagatctgtcactttctcctggatcatggagcagatgtcaattcc
aggaacaaaagtggaagaactgctctcatgctggcctgtgagattggcagctctaacgct
gtggaagccttaattaaaaagggtgcagacctaaaccttgtagattctcttggatacaat
gccttacattattccaaactctcagaaaatgcaggaattcaaagccttctattatcaaaa
atctctcaggatgctgatttaaagaccccaacaaaaccaaagcagcatgaccaagtctct
aaaataagctcagaaagaagtggaactccaaaaaaacgcaaagctccaccacctcctatc
agtcctacccagttgagtgatgtctcttccccaagatcaataacttcgactccactatcg
ggaaaggaatcggtattttttgctgaaccacccttcaaggctgagatcagttctatacga
gaaaacaaagacagactaagtgacagtactacaggtgctgatagcttattggatataagt
tctgaagctgaccaacaagatcttctctctctattgcaagcaaaagttgcttcccttacc
ttacacaataaggagttacaagataaattacaggccaaatcacccaaggaggcggaagca
gacctaagctttgactcataccattccacccaaactgacttgggcccatccctgggaaaa
cctggtgaaacctctcccccagactccaaatcatctccatctgtcttaatacattcttta
ggtaaatccactactgacaatgatgtcagaattcagcaactgcaagagattttgcaagat
ctacagaagagattagagagctctgaagcagagagaaaacagctacaggtcgaactccaa
tcccgaagggcagaactggtatgcttaaacaacactgagatttcagagaacagctctgac
ctcagccagaaacttaaagaaactcagagcaaatacgaggaggctatgaaagaagtcctt
agtgtgcagaagcagatgaaactcggtcttgtctcacctgaaagcatggataattattca
catttccacgagctgagggtcacggaagaggaaataaatgtgctaaagcaggatctgcag
aatgcattagaagaaagtgaaagaaataaagagaaagtgagagagttagaggaaaaactg
gtagagagggagaaaggtacagtgattaagccacctgtggaagagtacgaggaaatgaaa
agttcatattgctctgttattgagaatatgaataaggagaaagcatttttgtttgagaaa
taccaagaagcccaagaagaaatcatgaaattaaaagacacactaaaaagtcagatgaca
caggaagccagtgatgaagctgaggacatgaaagaagccatgaataggatgatagatgaa
ctcaataaacaggtgagcgagctgtcacagctgtacaaagaagcccaggctgagctggag
gattacaggaagaggaaatctctagaggatgtcacagctgaatatatccataaagcagag
catgagaaactgatgcaattgacaaacgtgtccagggctaaagcagaagatgcactgtct
gaaatgaagtctcagtattcaaaagtgttgaatgagttgacccagctcaaacaactggtg
gatgcacaaaaagagaactctgtctctatcacagaacatttgcaagtgataaccacgctg
cggactgcagcaaaagagatggaagaaaaaataagcaatcttaaggaacaccttgcaagc
aaggaagtggaagtagcaaagctggagaaacaactcttagaagagaaagctgctatgact
gatgcaatggtacctcggtcttcctatgaaaaactccagtcatccttagagagtgaagtg
agtgtgttggcatcgaaattaaaggaatctgtgaaagagaaagagaaggtccattcagag
gttgtccagattagaagtgaggtctcacaggtgaaaagagaaaaggaaaatattcagact
ctcttgaaatccaaagagcaagaagtaaatgaacttctgcaaaaattccagcaagctcag
gaagaacttgcagaaatgaaaagatacgctgagagctcttcaaaactggaggaagataaa
gataaaaagataaatgagatgtcgaaggaagtcaccaaattgaaggaggccttgaacagc
ctctcccagctctcctactcaacaagctcatccaaaaggcagagtcagcagctggaggcg
ctgcagcagcaagtcaaacagctccagaaccagctggcggaatgcaagaaacaacaccag
gaggtcatatcagtttacagaatgcatcttctgtatgctgtgcagggccagatggatgaa
gatgtccagaaagtactgaagcaaatccttaccatgtgtaaaaaccagtctcaaaagaag
taa

DBGET integrated database retrieval system