KEGG   Homo sapiens (human): 26084Help
Entry
26084             CDS       T01001                                 

Gene name
ARHGEF26, CSGEF, HMFN1864, SGEF
Definition
(RefSeq) Rho guanine nucleotide exchange factor 26
  KO
K13744  
Rho guanine nucleotide exchange factor 26
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    26084 (ARHGEF26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.2
AA seq 871 aa AA seqDB search
MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLL
AAQIPAQVPTASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAV
PGGSPKSPANGAVTLPAPPPPPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAA
NNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSP
AALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDN
DVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMEDKEKFSSLGRI
KKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTER
HHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQ
RTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDS
PKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRG
ELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNE
ELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHS
SGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF
PMECAKEITCQATIDKNVERMGRLLGLETNV
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgagagcgaggtggatttttctagcaacagcataacccctttgtggcggagg
cggtcgattcctcagccccaccaggttctgggccggagcaagccgaggccccagtcctac
cagagccccaacgggttactaattacggatttcccggtggaggacggagggacgctcctc
gcagcgcagattcccgcccaggtgcccaccgcctcggacagcaggacggtacataggagc
cccctgcttctgggcgcccagcggagagcggtggccaatggtgggacggcatccccggag
tacagggctgcctctcctcgacttcgacggcccaagtcacccaagctccccaaagcggtg
cctggcggctccccgaaatccccagcaaatggcgcggtgaccttgcctgcgccgccgccg
ccgccggttctgcgccccccgcggactcctaacgcgcccgccccctgcacccccgaggag
gaccttactgggttgactgccagcccggtgccttcgcccactgcaaatggccttgccgct
aataacgactctcctgggtcaggttcgcagtccggccggaaggcaaaggaccccgaacgg
gggctctttcctgggccccagaaaagttcttcggaacaaaaactccccctccaaaggctg
ccctcccaggagaacgagctcctcgagaatccttccgtggttttgagtacaaacagcccc
gccgccctcaaagtggggaagcagcagatcattccgaagagtctggcctcggaaattaaa
ataagtaaatccaacaatcaaaatgtggagccccacaagagactcctcaaggtgcgcagc
atggtggagggcctaggaggacccctgggtcacgcaggggaggagagtgaggtcgataac
gacgtggatagcccagggtctctgcggagaggcttgcggtccacgtcttatcgcagggca
gtggtcagtggctttgattttgacagtcctaccagctcgaagaagaagaacagaatgtcc
cagcctgttctgaaagtggtgatggaagacaaggagaagttttccagtctgggaaggata
aagaaaaaaatgctgaaaggacaaggaacatttgatggggaagaaaatgctgtcctgtat
caaaactacaaggaaaaggcccttgacattgattctgatgaagagtcagagcccaaagaa
cagaagtcagatgaaaaaattgtgattcaccataagccattgagatccacatggagccaa
ctctctgcggtgaaaagaaagggattatctcagacagtaagccaggaggaaagaaagaga
caagaggctatctttgaagtcatatcctctgaacattcatatttactcagcttggagatc
ttgatacgaatgtttaaaaattctaaagaactgagtgatacaatgactaaaaccgagagg
caccatcttttctccaatattacagatgtctgtgaggcaagcaaaaagttctttatagag
ttggaagcaagacatcagaataatatcttcatagatgacataagtgacattgtggaaaaa
cacacagcatccacatttgacccatatgtgaaatactgcacaaatgaagtctaccaacaa
cgaacactacaaaaattgttagctaccaatccatcctttaaggaagtattgtcaaggatt
gagtcccatgaagactgtaggaacttacccatgatctcttttctcattctccccatgcag
agggtgacccgccttcccctgctgatggatactatctgtcaaaaaacacctaaggactct
ccgaagtatgaagtctgcaaaagagccttgaaggaagttagcaagttggttcgactatgc
aatgagggcgcccggaagatggaaaggactgagatgatgtacacaattaactcccagctg
gaatttaaaattaagccttttcctttagtctcctcttcccggtggttggtaaaaagaggt
gaattgacagcctatgttgaagacactgtgcttttctcaagaaggacatccaaacagcaa
gtctacttctttctctttaacgatgtgctcattatcaccaagaagaagagtgaagaaagt
tacaacgtcaatgattattccttaagagatcagctattggtggaatcttgtgacaatgaa
gagcttaattcttctccagggaagaacagctccacaatgctctattcaagacagagctct
gccagtcacctctttactctgacagtccttagtaaccacgcgaatgagaaagtggagatg
ctactaggagctgagacgcagagcgagcgagcccgctggataactgccctgggacacagc
agcgggaagccgcctgcagaccgaacctcactgacccaggtggaaatcgttaggtcattt
actgctaagcagccagatgaactctccctgcaggtggctgacgtcgtcctcatctatcaa
cgtgtcagcgatggctggtatgagggggaacgactacgagatggagaaagaggctggttt
cctatggaatgtgccaaggagataacatgtcaagctacaattgataagaatgtggagaga
atgggacgcttgctaggactggagaccaacgtgtag

DBGET integrated database retrieval system