KEGG   Homo sapiens (human): 26084Help
Entry
26084             CDS       T01001                                 

Gene name
ARHGEF26, CSGEF, HMFN1864, SGEF
Definition
Rho guanine nucleotide exchange factor (GEF) 26
Orthology
K13744  
SH3 domain-containing guanine exchange factor
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    26084 (ARHGEF26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.2
AA seq 871 aa AA seqDB search
MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITDFPVEDGGTLL
AAQIPAQVPTASDSRTVHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAV
PGGSPKSPANGAVTLPAPPPPPVLRPPRTPNAPAPCTPEEDLTGLTASPVPSPTANGLAA
NNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSP
AALKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEVDN
DVDSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKVVMEDKEKFSSLGRI
KKKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQ
LSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTER
HHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQ
RTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDS
PKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRG
ELTAYVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNE
ELNSSPGKNSSTMLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHS
SGKPPADRTSLTQVEIVRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWF
PMECAKEITCQATIDKNVERMGRLLGLETNV
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgagagcgaggtggatttttctagcaacagcataacccctttgtggcggagg
cggtcgattcctcagccccaccaggttctgggccggagcaagccgaggccccagtcctac
cagagccccaacgggttactaattacggatttcccggtggaggacggagggacgctcctc
gcagcgcagattcccgcccaggtgcccaccgcctcggacagcaggacggtacataggagc
cccctgcttctgggcgcccagcggagagcggtggccaatggtgggacggcatccccggag
tacagggctgcctctcctcgacttcgacggcccaagtcacccaagctccccaaagcggtg
cctggcggctccccgaaatccccagcaaatggcgcggtgaccttgcctgcgccgccgccg
ccgccggttctgcgccccccgcggactcctaacgcgcccgccccctgcacccccgaggag
gaccttactgggttgactgccagcccggtgccttcgcccactgcaaatggccttgccgct
aataacgactctcctgggtcaggttcgcagtccggccggaaggcaaaggaccccgaacgg
gggctctttcctgggccccagaaaagttcttcggaacaaaaactccccctccaaaggctg
ccctcccaggagaacgagctcctcgagaatccttccgtggttttgagtacaaacagcccc
gccgccctcaaagtggggaagcagcagatcattccgaagagtctggcctcggaaattaaa
ataagtaaatccaacaatcaaaatgtggagccccacaagagactcctcaaggtgcgcagc
atggtggagggcctaggaggacccctgggtcacgcaggggaggagagtgaggtcgataac
gacgtggatagcccagggtctctgcggagaggcttgcggtccacgtcttatcgcagggca
gtggtcagtggctttgattttgacagtcctaccagctcgaagaagaagaacagaatgtcc
cagcctgttctgaaagtggtgatggaagacaaggagaagttttccagtctgggaaggata
aagaaaaaaatgctgaaaggacaaggaacatttgatggggaagaaaatgctgtcctgtat
caaaactacaaggaaaaggcccttgacattgattctgatgaagagtcagagcccaaagaa
cagaagtcagatgaaaaaattgtgattcaccataagccattgagatccacatggagccaa
ctctctgcggtgaaaagaaagggattatctcagacagtaagccaggaggaaagaaagaga
caagaggctatctttgaagtcatatcctctgaacattcatatttactcagcttggagatc
ttgatacgaatgtttaaaaattctaaagaactgagtgatacaatgactaaaaccgagagg
caccatcttttctccaatattacagatgtctgtgaggcaagcaaaaagttctttatagag
ttggaagcaagacatcagaataatatcttcatagatgacataagtgacattgtggaaaaa
cacacagcatccacatttgacccatatgtgaaatactgcacaaatgaagtctaccaacaa
cgaacactacaaaaattgttagctaccaatccatcctttaaggaagtattgtcaaggatt
gagtcccatgaagactgtaggaacttacccatgatctcttttctcattctccccatgcag
agggtgacccgccttcccctgctgatggatactatctgtcaaaaaacacctaaggactct
ccgaagtatgaagtctgcaaaagagccttgaaggaagttagcaagttggttcgactatgc
aatgagggcgcccggaagatggaaaggactgagatgatgtacacaattaactcccagctg
gaatttaaaattaagccttttcctttagtctcctcttcccggtggttggtaaaaagaggt
gaattgacagcctatgttgaagacactgtgcttttctcaagaaggacatccaaacagcaa
gtctacttctttctctttaacgatgtgctcattatcaccaagaagaagagtgaagaaagt
tacaacgtcaatgattattccttaagagatcagctattggtggaatcttgtgacaatgaa
gagcttaattcttctccagggaagaacagctccacaatgctctattcaagacagagctct
gccagtcacctctttactctgacagtccttagtaaccacgcgaatgagaaagtggagatg
ctactaggagctgagacgcagagcgagcgagcccgctggataactgccctgggacacagc
agcgggaagccgcctgcagaccgaacctcactgacccaggtggaaatcgttaggtcattt
actgctaagcagccagatgaactctccctgcaggtggctgacgtcgtcctcatctatcaa
cgtgtcagcgatggctggtatgagggggaacgactacgagatggagaaagaggctggttt
cctatggaatgtgccaaggagataacatgtcaagctacaattgataagaatgtggagaga
atgggacgcttgctaggactggagaccaacgtgtag

DBGET integrated database retrieval system