KEGG   Homo sapiens (human): 26090Help
Entry
26090             CDS       T01001                                 

Gene name
ABHD12, ABHD12A, BEM46L2, C20orf22, PHARC, dJ965G21.2
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hsa  Homo sapiens (human)
Disease
H01115  
Polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract (PHARC)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     26090 (ABHD12)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   26090 (ABHD12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   26090 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8N2K0(Tchem)
UniProt: 
Position
20p11.21
AA seq 398 aa AA seqDB search
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKR
ALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQ
FVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcgccttggagcatgagcgctgcgccgccgcgggctcg
tcctcctccggctcggccgccgcggcgctggacgccgactgccgcctgaagcagaaccta
cgcctgacgggcccggcggcggctgagccgcgctgcgcagccgacgcgggaatgaagcgg
gcgctgggcaggcgaaagggcgtgtggttgcgcctgaggaagatacttttctgtgttttg
gggttgtacattgccattccatttctcatcaaactatgtcctggaatacaggccaaactg
attttcttgaatttcgtaagagttccctatttcattgatttgaaaaaaccacaggatcaa
ggtttgaatcacacgtgtaactactacctgcagccagaggaagacgtgaccattggagtc
tggcacaccgtccctgcagtctggtggaagaacgcccaaggcaaagaccagatgtggtat
gaggatgccttggcttccagccaccctatcattctgtacctgcatgggaacgcaggtacc
agaggaggcgaccaccgcgtggagctttacaaggtgctgagttcccttggttaccatgtg
gtcacctttgactacagaggttggggtgactcagtgggaacgccatctgagcggggcatg
acctatgacgcactccacgtttttgactggatcaaagcaagaagtggtgacaaccccgtg
tacatctggggccactctctgggcactggcgtggcgacaaatctggtgcggcgcctctgt
gagcgagagacgcctccagatgcccttatattggaatctccattcactaatatccgcgaa
gaagctaagagccatccattttcagtgatatatcgatacttccctgggtttgactggttc
ttccttgatcctattacaagtagtggaattaaatttgcaaatgatgaaaacgtgaagcac
atctcctgtcccctgctcatcctgcacgctgaggacgacccggtggtgcccttccagctt
ggcagaaagctctatagcatcgccgcaccagctcgaagcttccgagatttcaaagttcag
tttgtgccctttcattcagaccttggctacaggcacaaatacatttacaagagccctgag
ctgccacggatactgagggaattcctggggaagtcggagcctgagcaccagcactga

DBGET integrated database retrieval system