KEGG   Homo sapiens (human): 26095Help
Entry
26095             CDS       T01001                                 

Gene name
PTPN20B, CT126, PTPN20A, bA142I17.1, bA42B19.1, hPTPN20
Definition
protein tyrosine phosphatase, non-receptor type 20B (EC:3.1.3.48)
Orthology
K18039  
tyrosine-protein phosphatase non-receptor type 20 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     26095 (PTPN20B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q11.22
AA seq 420 aa AA seqDB search
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVS
EGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQ
PSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW
QMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMF
QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRT
GVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacctagggactttagagcagagcctgtaaacgattatgagggaaatgactct
gaagcagaagacttgaatttcagggagactttgccttcatcaagtcaggaaaacacacct
agatcaaaggtttttgaaaataaagttaattcagagaaggtaaaactttctcttcggaat
ttcccacataatgattatgaggatgtttttgaagagccttcagaaagtggcagtgatccc
agcatgtggacagccagaggccccttcagaagagacaggtggagcagtgaggatgaggag
gctgcagggccatcacaggctctctcccctctactttctgatacgcgcaaaattgtttct
gaaggagaactagatcagttggctcagattcggccattaatattcaattttcatgagcag
acagccatcaaggattgtttgaaaatccttgaggaaaaaacagcagcgtatgatatcatg
caggaatttatggctttagaacttaagaatctgcctggtgagttcaactctgggaatcaa
ccaagcaacagagaaaaaaatagataccgagatattcttccatatgattcaacacgcgtt
cctcttggaaaaagcaaggactacatcaatgctagttatattagaatagtcaattgtgga
gaagagtatttttatatcgctactcaaggaccactgctgagcaccatagatgacttttgg
caaatggtgttggaaaataattcaaatgttattgccatgataaccagagagatagaaggt
ggaattatcaaatgctaccattactggcccatttctctgaagaagccattggaattgaaa
cacttccgtgtattcctggagaactaccagatacttcaatatttcatcattcgaatgttt
caagttgtggagaagtccacgggaactagtcactctgtaaaacagttgcagttcaccaag
tggccagaccatggcactcctgcctcagcagatagcttcataaaatatattcgttatgca
aggaagagccaccttacaggacccatggttgttcactgcagtgccggcataggccggaca
ggggtgttcctatgtgtggatgtcgtgttctgtgccatcgtaaagaactgttcattcaac
atcatggatatagtggcccaaatgagagaacaacgttctggcatggttcaaacgaaggag
cagtatcacttttgttacgatattgtgcttgaagttcttcggaaacttctgactttggat
taa

DBGET integrated database retrieval system