KEGG   Homo sapiens (human): 26156Help
Entry
26156             CDS       T01001                                 

Gene name
RSL1D1, CSIG, L12, PBK1, UTP30
Definition
(RefSeq) ribosomal L1 domain containing 1
  KO
K14775  
ribosome biogenesis protein UTP30
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    26156 (RSL1D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.13
AA seq 490 aa AA seqDB search
MEDSASASLSSAAATGTSTSTPAAPTARKQLDKEQVRKAVDALLTHCKSRKNNYGLLLNE
NESLFLMVVLWKIPSKELRVRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNK
HGIKTVSQIISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVP
VSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENIVAVTKGLSEK
LPEKWESVKLLFVKTEKSAALPIFSSFVSNWDEATKRSLLNKKKKEARRKRRERNFEKQK
ERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNE
SEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAE
SETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKW
PKKPKVPQST
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaggattcggcctcggcctcgctgtcttctgcagccgctactggaacctccacctcg
actccagcggccccgacagcacggaagcagctggataaagaacaggttagaaaggcagtg
gacgctctcttgacgcattgcaagtccaggaaaaacaattatgggttgcttttgaatgag
aatgaaagtttatttttaatggtggtattatggaaaattccaagtaaagaactgagggtc
agattgaccttgcctcatagtattcgatcagattcagaagatatctgtttatttacgaag
gatgaacccaattcaactcctgaaaagacagaacagttttatagaaagcttttaaacaag
catggaattaaaaccgtttctcagattatctccctccaaactctaaagaaggaatataaa
tcctatgaagccaagctccgccttctgagcagttttgatttcttccttactgatgccaga
attaggcggctcttaccctcactcattgggagacatttctatcaaagaaagaaagttcca
gtatctgtaaaccttctgtccaagaatttatcaagagagatcaatgactgtataggtgga
acagtcttaaacatttctaaaagtggttcttgcagtgctatacgtattggtcacgttgga
atgcaaattgagcacatcattgaaaacattgttgctgtcaccaaaggactttcagaaaaa
ttgccagagaagtgggagagcgtgaaactcctgtttgtgaaaactgagaaatcggctgca
cttcccatcttttcctcgtttgtcagcaattgggatgaagccaccaaaagatctttgctt
aataagaagaaaaaagaggcaaggagaaaacgaagagaaagaaattttgaaaaacaaaag
gagaggaagaagaagaggcagcaggctaggaagactgcatcagttcttagtaaagatgat
gtggcacctgaaagtggtgatactacagtgaagaaacctgaatcaaagaaggaacagacc
ccagagcatgggaagaaaaaacgtggcagaggaaaagcccaagttaaagcaacaaatgaa
tccgaagacgaaatcccacagctggtaccaataggaaagaagactccagctaatgaaaaa
gtagagattcaaaaacatgccacaggaaagaagtctccagcaaagagtcctaatcccagc
acacctcgtgggaagaaaagaaaggctttgccagcatctgagaccccaaaagctgcagag
tctgagaccccagggaaaagcccagagaagaagccaaaaatcaaagaagaggcagtgaag
gaaaaaagtccttcgctggggaaaaaagatgcgagacagactccaaaaaagccagaggcc
aagtttttcaccactcctagtaaatctgtgagaaaagcttcccacacccccaaaaaatgg
cccaaaaaacccaaagtaccccagtcgacctaa

DBGET integrated database retrieval system