KEGG   Homo sapiens (human): 261729Help
Entry
261729            CDS       T01001                                 

Gene name
STEAP2, IPCA1, PCANAP1, PUMPCn, STAMP1, STMP
Definition
STEAP family member 2, metalloreductase
Orthology
K14738  
metalloreductase STEAP2 [EC:1.16.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    261729 (STEAP2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     261729 (STEAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.13
AA seq 490 aa AA seqDB search
MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGS
RNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNM
RINQYPESNAEYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIE
LARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYA
RNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQ
CRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWNEEEVWRIEMY
ISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFE
EEYYRFYTPPNFVLALVLPSIVILGKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIP
HVSPERVTVM
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaatctctatgatgggaagccctaagagccttagtgaaacttttttacctaat
ggcataaatggtatcaaagatgcaaggaaggtcactgtaggtgtgattggaagtggagat
tttgccaaatccttgaccattcgacttattagatgcggctatcatgtggtcataggaagt
agaaatcctaagtttgcttctgaattttttcctcatgtggtagatgtcactcatcatgaa
gatgctctcacaaaaacaaatataatatttgttgctatacacagagaacattatacctcc
ctgtgggacctgagacatctgcttgtgggtaaaatcctgattgatgtgagcaataacatg
aggataaaccagtacccagaatccaatgctgaatatttggcttcattattcccagattct
ttgattgtcaaaggatttaatgttgtctcagcttgggcacttcagttaggacctaaggat
gccagccggcaggtttatatatgcagcaacaatattcaagcgcgacaacaggttattgaa
cttgcccgccagttgaatttcattcccattgacttgggatccttatcatcagccagagag
attgaaaatttacccctacgactctttactctctggagagggccagtggtggtagctata
agcttggccacattttttttcctttattcctttgtcagagatgtgattcatccatatgct
agaaaccaacagagtgacttttacaaaattcctatagagattgtgaataaaaccttacct
atagttgccattactttgctctccctagtatacctcgcaggtcttctggcagctgcttat
caactttattacggcaccaagtataggagatttccaccttggttggaaacctggttacag
tgtagaaaacagcttggattactaagttttttcttcgctatggtccatgttgcctacagc
ctctgcttaccgatgagaaggtcagagagatatttgtttctcaacatggcttatcagcag
gttcatgcaaatattgaaaactcttggaatgaggaagaagtttggagaattgaaatgtat
atctcctttggcataatgagccttggcttactttccctcctggcagtcacttctatccct
tcagtgagcaatgctttaaactggagagaattcagttttattcagtctacacttggatat
gtcgctctgctcataagtactttccatgttttaatttatggatggaaacgagcttttgag
gaagagtactacagattttatacaccaccaaactttgttcttgctcttgttttgccctca
attgtaattctgggtaagattattttattccttccatgtataagccgaaagctaaaacga
attaaaaaaggctgggaaaagagccaatttctggaagaaggtatgggaggaacaattcct
catgtctccccggagagggtcacagtaatgtga

DBGET integrated database retrieval system