KEGG   Homo sapiens (human): 26188Help
Entry
26188             CDS       T01001                                 

Gene name
OR1C1, HSTPCR27, OR1-42, OR1.5.10, ORL211, TPCR27
Definition
olfactory receptor, family 1, subfamily C, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26188 (OR1C1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26188 (OR1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q44
AA seq 314 aa AA seqDB search
MEKRNLTVVREFVLLGLPSSAEQQHLLSVLFLCMYLATTLGNMLIIATIGFDSHLHSPMY
FFLSNLAFVDICFTSTTVPQMVVNILTGTKTISFAGCLTQLFFFVSFVNMDSLLLCVMAY
DRYVAICHPLHYTARMNLCLCVQLVAGLWLVTYLHALLHTVLIAQLSFCASNIIHHFFCD
LNPLLQLSCSDVSFNVMIIFAVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVST
CSCHLSVVVLFYGTAIAVYFSPSSPHMPESDTLSTIMYSMVAPMLNPFIYTLRNRDMKRG
LQKMLLKCTVFQQQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagaaatctaacagttgtcagggaattcgtccttctgggacttcctagctca
gcagagcagcagcacctcctgtctgtgctctttctctgtatgtatttagccaccaccttg
gggaacatgctcatcattgcgacgattggctttgactctcacctccattcccctatgtac
ttcttccttagtaacttggcctttgttgacatctgctttacgtcgactacagtcccccaa
atggtagtgaatatcttgactggcaccaagactatctcttttgcaggctgcctcacccag
ctcttcttcttcgtttcttttgtgaatatggacagcctccttctgtgtgtgatggcgtat
gatagatatgtggcgatttgccaccccttacattacaccgccagaatgaacctgtgcctt
tgtgtccagctagtggctggactgtggcttgttacttacctccacgccctcctgcatact
gtcctaatagcacagctgtccttctgtgcctccaatatcatccatcatttcttctgtgat
ctcaatcctctcctgcagctctcttgctctgacgtctccttcaatgtaatgatcattttt
gcagtaggaggtctattggctctcacgccccttgtctgtatcctcgtatcttatggactt
atcttctccactgttctgaagatcacctctactcagggcaagcagagagctgtttccacc
tgcagctgccacctgtcagtggtggtgttgttttacggcacagccatcgccgtctatttc
agcccttcatccccccatatgcctgagagcgacactctgtcaaccatcatgtattcaatg
gtggctccgatgctgaatcctttcatctataccctaaggaacagggatatgaagagggga
cttcagaaaatgcttctcaagtgcacagtctttcagcagcaataa

DBGET integrated database retrieval system