KEGG   Homo sapiens (human): 26191Help
Entry
26191             CDS       T01001                                 

Gene name
PTPN22, LYP, LYP1, LYP2, PEP, PTPN8
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 22 (EC:3.1.3.48)
  KO
K18024  
tyrosine-protein phosphatase non-receptor type 12/18/22 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Disease
H00408  
Type I diabetes mellitus
H01492  
Systemic sclerosis
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     26191 (PTPN22)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    26191 (PTPN22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.2
AA seq 807 aa AA seqDB search
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRY
KDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQMDVIRDK
HSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKESSSFDFRTSE
ISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSC
FVEMQAQKVMHVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSW
PPSGTSSKMSLDLPEKQDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQES
AVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSLEWGGTS
EPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPERTLESFFLADEDCMQAQSIET
YSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNKPAESVQSNNS
SSFLNFGFANRFSKPKGPRNPPPTWNI
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaagagaaattctgcagaagttcctggatgaggcccaaagcaagaaaattact
aaagaggagtttgccaatgaatttctgaagctgaaaaggcaatctaccaagtacaaggca
gacaaaacctatcctacaactgtggctgagaagcccaagaatatcaagaaaaacagatat
aaggatattttgccctatgattatagccgggtagaactatccctgataacctctgatgag
gattccagctacatcaatgccaacttcattaagggagtttatggacccaaggcttatatt
gccacccagggtcctttatctacaaccctcctggacttctggaggatgatttgggaatat
agtgtccttatcattgttatggcatgcatggagtatgaaatgggaaagaaaaagtgtgag
cgctactgggctgagccaggagagatgcagctggaatttggccctttctctgtatcctgt
gaagctgaaaaaaggaaatctgattatataatcaggactctaaaagttaagttcaatagt
gaaactcgaactatctaccagtttcattacaagaattggccagaccatgatgtaccttca
tctatagaccctattcttgagctcatctgggatgtacgttgttaccaagaggatgacagt
gttcccatatgcattcactgcagtgctggctgtggaaggactggtgttatttgtgctatt
gattatacatggatgttgctaaaagatgggataattcctgagaacttcagtgttttcagt
ttgatccgggaaatgcggacacagaggccttcattagttcaaacgcaggaacaatatgaa
ctggtctacaatgctgtattagaactatttaagagacagatggatgttatcagagataaa
cattctggaacagagagtcaagcaaagcattgtattcctgagaaaaatcacactctccaa
gcagactcttattctcctaatttaccaaaaagtaccacaaaagcagcaaaaatgatgaac
caacaaaggacaaaaatggaaatcaaagaatcttcttcctttgactttaggacttctgaa
ataagtgcaaaagaagagctagttttgcaccctgctaaatcaagcacttcttttgacttt
ctggagctaaattacagttttgacaaaaatgctgacacaaccatgaaatggcagacaaag
gcatttccaatagttggggagcctcttcagaagcatcaaagtttggatttgggctctctt
ttgtttgagggatgttctaattctaaacctgtaaatgcagcaggaagatattttaattca
aaggtgccaataacacggaccaaatcaactccttttgaattgatacagcagagagaaacc
aaggaggtggacagcaaggaaaacttttcttatttggaatctcaaccacatgattcttgt
tttgtagagatgcaggctcaaaaagtaatgcatgtttcttcagcagaactgaattattca
ctgccatatgactctaaacaccaaatacgtaatgcctctaatgtaaagcaccatgactct
agtgctcttggtgtatattcttacatacctttagtggaaaatccttatttttcatcatgg
cctccaagtggtaccagttctaagatgtctcttgatttacctgagaagcaagatggaact
gtttttccttcttctctgttgccaacatcctctacatccctcttctcttattacaattca
catgattctttatcactgaattctccaaccaatatttcctcactattgaaccaggagtca
gctgtactagcaactgctccaaggatagatgatgaaatcccccctccacttcctgtacgg
acacctgaatcatttattgtggttgaggaagctggagaattctcaccaaatgttcccaaa
tccttatcctcagctgtgaaggtaaaaattggaacatcactggaatggggtggaacatct
gaaccaaagaaatttgatgactctgtgatacttagaccaagcaagagtgtaaaactccga
agtcctaaatcagaactacatcaagatcgttcttctcccccacctcctctcccagaaaga
actctagagtccttctttcttgccgatgaagattgtatgcaggcccaatctatagaaaca
tattctactagctatcctgacaccatggaaaattcaacatcttcaaaacagacactgaag
actcctggaaaaagtttcacaaggagtaagagtttgaaaattttgcgaaacatgaaaaag
agtatctgtaattcttgcccaccaaacaagcctgcagaatctgttcagtcaaataactcc
agctcatttctgaattttggttttgcaaaccgtttttcaaaacccaaaggaccaaggaat
ccaccaccaacttggaatatttaa

DBGET integrated database retrieval system