KEGG   Homo sapiens (human): 26211Help
Entry
26211             CDS       T01001                                 

Gene name
OR2F1, 7M1-2, OLF3, OR14-60, OR2F3, OR2F3P, OR2F4, OR2F5, OR7-139, OR7-140
Definition
(RefSeq) olfactory receptor family 2 subfamily F member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26211 (OR2F1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26211 (OR2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 26211
NCBI-ProteinID: NP_036501
OMIM: 608497
HGNC: 8246
Ensembl: ENSG00000213215
Vega: OTTHUMG00000157771
Pharos: Q13607(Tdark)
UniProt: Q13607 A0A126GV98
Position
7q35
AA seq 317 aa AA seqDB search
MGTDNQTWVSEFILLGLSSDWDTRVSLFVLFLVMYVVTVLGNCLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY
DRYVAVCDALRYSAIMHGGLCARLAITSWVSGFISSPVQTAITFQLPMCRNKFIDHISCE
LLAVVRLACVDTSSNEVTIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSREGRKKAFHT
CASHLTVVALCYGVAIFTYIQPHSSPSVLQEKLFSVFYAILTPMLNPMIYSLRNKEVKGA
WQKLLWKFSGLTSKLAT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagataaccagacttgggtgagtgaatttattctcctcggcctgtccagtgac
tgggacactcgggtctccctgtttgtcctgttcttggtcatgtatgtggtgaccgtgctg
gggaactgtctcattgtccttctgatcagactggacagccgactccacactcccatgtat
ttctttctcaccaacctctcccttgtcgatgtctcctatgccacaagtgtagtccctcag
ctgctggcacattttcttgcagaacataaagccatcccattccagagctgtgcagcccag
ttatttttctccctggccttgggtgggattgagtttgttctcctggcggtgatggcctat
gaccgctatgtggctgtgtgtgatgccctgcgatactcggccatcatgcatggagggctg
tgtgctaggttggccatcacatcctgggtcagtggcttcatcagctctcctgtgcagact
gctatcacctttcagctgcccatgtgcagaaacaagtttattgatcacatatcctgtgaa
ctcctagctgtggtcaggctggcttgtgtggacacctcctccaatgaggtcaccatcatg
gtgtctagcattgttcttctgatgacacccttctgcctggttcttttgtcctacatccag
atcatctccaccatcctaaagatccagtccagagaaggaagaaagaaagctttccacacg
tgtgcctctcacctcacagtggttgccctgtgctatggtgtggccattttcacttacatc
cagccccactccagtccctctgtccttcaggagaagttgttctctgtcttttatgccatt
ttaacaccaatgctgaaccccatgatttacagcctaaggaataaagaggtgaagggggcc
tggcagaaactattatggaaattctctgggttaacatcaaagctggcaacttga

DBGET integrated database retrieval system