KEGG   Homo sapiens (human): 26212Help
Entry
26212             CDS       T01001                                 

Gene name
OR2B6, OR2B1, OR2B1P, OR2B5, OR2B6P, OR5-40, OR5-41, OR6-31, dJ408B20.2
Definition
olfactory receptor, family 2, subfamily B, member 6
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26212 (OR2B6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26212 (OR2B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 313 aa AA seqDB search
MNWVNDSIIQEFILLGFSDRPWLEFPLLVVFLISYTVTIFGNLTIILVSRLDTKLHTPMY
FFLTNLSLLDLCYTTCTVPQMLVNLCSIRKVISYRGCVAQLFIFLALGATEYLLLAVMSF
DRFVAICRPLHYSVIMHQRLCLQLAAASWVTGFSNSVWLSTLTLQLPLCDPYVIDHFLCE
VPALLKLSCVETTANEAELFLVSELFHLIPLTLILISYAFIVRAVLRIQSAEGRQKAFGT
CGSHLIVVSLFYSTAVSVYLQPPSPSSKDQGKMVSLFYGIIAPMLNPLIYTLRNKEVKEG
FKRLVARVFLIKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaattgggtaaatgacagcatcatacaggagtttattctgctgggtttctcagatcga
ccttggctggagtttccactccttgtggtcttcttgatttcttacactgtgaccatcttt
ggcaatctgaccattattctagtgtcacgcctggacaccaaacttcatacccccatgtat
ttttttcttaccaatctatcactcctggatctttgttacaccacatgtacagtcccacaa
atgctagtaaatttatgcagcatcaggaaagtaatcagttatcgtggctgtgtagcccag
cttttcatatttctggccttgggggctactgaatatcttctcctggccgtcatgtccttt
gataggtttgtagctatttgtcggcctctccattactcagttatcatgcaccagagactc
tgcctccagttggcagctgcatcctgggttactggttttagtaactcagtgtggttgtct
accctgactctccagctgccactctgtgacccctatgtgatagatcactttctctgtgaa
gtccctgcactgctcaagttatcttgtgttgagacaacagcaaatgaggctgaactattc
cttgtcagtgagctcttccatctaatacccctgacactcatccttatatcatatgctttt
attgtccgagcagtattgaggatacagtctgctgaaggtcgacaaaaagcatttgggaca
tgtggttcccatctaattgtggtgtctcttttttatagtacagccgtctctgtgtacctg
caaccaccttcgcccagctccaaggaccaaggaaagatggtttctctcttctatggaatc
attgcacccatgctgaatccccttatatatacacttaggaacaaggaggtaaaggaaggc
tttaaaaggttggttgcaagagtcttcttaatcaagaaataa

DBGET integrated database retrieval system