KEGG   Homo sapiens (human): 26219Help
Entry
26219             CDS       T01001                                 

Gene name
OR1J4, HSHTPCRX01, HTPCRX01, OR9-21
Definition
olfactory receptor, family 1, subfamily J, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26219 (OR1J4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26219 (OR1J4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 313 aa AA seqDB search
MKRENQSSVSEFLLLDLPIWPEQQAVFFTLFLGMYLITVLGNLLIILLIRLDSHLHTPMF
FFLSHLALTDISLSSVTVPKMLLSMQTQDQSILYAGCVTQMYFFIFFTDLDNFLLTSMAY
DRYVAICHPLRYTTIMKEGLCNLLVTVSWILSCTNALSHTLLLAQLSFCADNTIPHFFCD
LVALLKLSCSDISLNELVIFTVGQAVITLPLICILISYGHIGVTILKAPSTKGIFKALST
CGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLNPFIYSLRNRDIKGA
LERLFNRATVLSQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaagagggagaatcagagcagtgtgtctgagttcctcctcctggacctccccatctgg
ccagagcagcaggctgtgttcttcaccctgttcttgggcatgtacctgatcacggtgctg
gggaacctgctcatcatcctgctcatccggctggactctcaccttcacacccccatgttc
ttcttcctcagccacttggctctcactgacatctccctttcatctgtcactgtcccaaag
atgttattaagcatgcaaactcaggatcaatccattctttatgcagggtgtgtaactcag
atgtattttttcatatttttcactgatctagacaatttccttctcacttcaatggcatac
gatcggtatgtggccatctgtcaccccctccgctacaccactatcatgaaagagggactg
tgtaacttactagtcactgtgtcctggatcctctcctgtaccaatgccctgtctcacact
ctcctcctggcccagctgtccttttgtgctgacaacaccatcccccatttcttctgtgat
cttgttgccctactcaagctctcatgctcagacatctccctcaatgagctggtcattttc
acagtgggacaggcagtcattactctaccactaatatgcatcttgatctcttatggccac
attggggtcaccatcctcaaggctccatctactaagggcatcttcaaagctttgtccacc
tgtggctctcacctctctgtggtgtctctgtattatggcacaattattggactgtatttt
ctcccctcatccagtgcctccagtgacaaggacgtaattgcctctgtgatgtacacggtg
atcaccccattgctgaatcccttcatttatagcctaaggaacagggacataaagggagcc
ctggagagactcttcaacagggcaacagtcttatctcaatga

DBGET integrated database retrieval system