KEGG   Homo sapiens (human): 26230Help
Entry
26230             CDS       T01001                                 

Gene name
TIAM2, STEF, TIAM-2
Definition
T-cell lymphoma invasion and metastasis 2
Orthology
K16847  
T-lymphoma invasion and metastasis-inducing protein 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.2
AA seq 626 aa AA seqDB search
MEGPRENQDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQNETFL
TQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYA
DHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKY
PLLLKELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTE
KEVTELSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPS
NSRPAHNSTDLDPFKFRWLIPISALQVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQL
CCSDSESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSL
KVLKNSSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQDSKSTSPGKYPHPGLA
DFADNLIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPES
GEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLE
REFSVQSLTSVVSEECFYETESHGKS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaccgcgggagaatcaggatcctcctccgaggcctctggcccgccacctgtct
gatgcagaccgcctccgcaaagtcatccaggagcttgtggacacagagaagtcctacgtg
aaggatttgagctgcctctttgaattatacttggagccacttcagaatgagacctttctt
acccaagatgagatggagtcactttttggaagtttgccagagatgcttgagtttcagaag
gtgtttctggagaccctggaggatgggatttcagcatcatctgactttaacaccctagaa
accccctcacagtttagaaaattactgttttcccttggaggctctttcctttattacgcg
gaccactttaaactgtacagtggattctgtgctaaccatatcaaagtacagaaggttctg
gagcgagctaaaactgacaaagccttcaaggcttttctggacgcccggaaccccaccaag
cagcattcctccacgctggagtcctacctcatcaagccggttcagagagtgctcaagtac
ccgctgctgctcaaggagctggtgtccctgacggaccaggagagcgaggagcactaccac
ctgacggaagcactaaaggcaatggagaaagtagcgagccacatcaatgagatgcagaag
atctatgaggattatgggaccgtgtttgaccagctagtagctgagcagagcggaacagag
aaggaggtaacagaactttcgatgggagagcttctgatgcactctacggtttcctggttg
aatccatttctgtctctaggaaaagctagaaaggaccttgagctcacagtatttgttttt
aagagagccgtcatactggtttataaagaaaactgcaaactgaaaaagaaattgccctcg
aattcccggcctgcacacaactctactgacttggacccatttaaattccgctggttgatc
cccatctccgcgcttcaagtcagactggggaatccagcagggacagaaaataattccata
tgggaactgatccatacgaagtcagaaatagaaggacggccagaaaccatctttcagttg
tgttgcagtgacagtgaaagcaaaaccaacattgttaaggtgattcgttctattctgagg
gagaacttcaggcgtcacataaagtgtgaattaccactggagaaaacgtgtaaggatcgc
ctggtacctcttaagaaccgagttcctgtttcggccaaattagcttcatccaggtcttta
aaagtcctgaagaattcctccagcaacgagtggaccggtgagactggcaagggaaccttg
ctggactctgacgagggcagcttgagcagcggcacccagagcagcggctgccccacggct
gagggcaggcaggactccaagagcacttctcccgggaaatacccacaccccggcttggca
gattttgccgacaatctcatcaaagagagtgacatcctgagcgatgaagatgatgaccac
cgtcagactgtgaagcagggcagccctactaaagacatcgaaattcagttccagagactg
aggatttccgaggacccagacgttcaccccgaggctgagcagcagcctggcccggagtcg
ggtgagggtcagaaaggaggagagcagcccaaactggtccgggggcacttctgccccatt
aaacgaaaagccaacagcaccaagagggacagaggaactttgctcaaggcgcagatccgt
caccagtcccttgacagtcagtctgaaaatgccaccatcgacctaaattctgttctagag
cgagaattcagtgtccagagtttaacatctgttgtcagtgaggagtgtttttatgaaaca
gagagccacggaaaatcatag

DBGET integrated database retrieval system