KEGG   Homo sapiens (human): 26251Help
Entry
26251             CDS       T01001                                 

Gene name
KCNG2, KCNF2, KV6.2
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily G member 2
  KO
K04901  
potassium voltage-gated channel subfamily G member 2
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNG, Kv6.x
   26251 (KCNG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q23
AA seq 466 aa AA seqDB search
MEPWPCSPGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDDLLRVCD
DYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCCL
RRLRRREEEAAEARAGPTERGAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLFA
CVSVSFVAVTAVGLCLSTMPDIRAEEERGECSPKCRSLFVLETVCVAWFSFEFLLRSLQA
ESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLLERAGLVLRLLRALRVLYVMR
LARHSLGLRSLGLTMRRCAREFGLLLLFLCVAMALFAPLVHLAERELGARRDFSSVPASY
WWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQ
RAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWVRAGR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggagccatggccctgctccccgggcggcggcggcgggacccgcgcccggcacgtcatc
atcaacgtgggcggctgccgcgtgcgcctggcatgggccgcgctggcgcgatgccccctc
gcgcgcctggagcgcctgcgcgcctgccgcggccacgacgacctgctgcgcgtgtgtgac
gactacgacgtgagccgcgacgagttcttcttcgaccgcagcccgtgcgccttccgcgcc
atcgtggcgcttttgcgcgcagggaagctgcgactgctgcggggcccgtgcgcgctggcc
ttccgcgacgagctggcctactggggcatcgacgaggcgcgcctggagcgctgctgcctg
cgccgcctgcgccgccgcgaggaggaggcggccgaggcccgcgcggggccgacggagcgc
ggggcgcaggggagcccggcgcgcgccctgggacctcgggggcggctgcagcgcggccgg
cggcgcctgcgcgacgtggtggacaacccgcactcggggctggcgggcaagctcttcgcc
tgcgtgtccgtgtccttcgtggccgtcacggccgtgggcctctgcctgagcaccatgccg
gacatccgcgccgaggaggagcggggcgagtgctcccccaagtgccgcagcctgttcgtg
ctggagaccgtgtgcgtggcctggttctccttcgagttcctgctgcgctccctgcaggcc
gagagcaagtgcgccttcctgcgcgcgccactcaacatcattgacatcctggcgctcctg
ccgttctacgtgtcgctgctgctggggctggcggcaggcccgggcgggaccaagctcctg
gagcgcgcggggctggtgctgcggctgctgcgtgcgctgcgcgtgctctacgtgatgcgc
ctggcgcgccactcgctggggctgcgttcgctgggcctgaccatgcgccgctgcgcgcgc
gagttcgggctgctgctgctgttcctctgcgtggccatggcgctcttcgcgccactggtg
cacctggccgagcgcgagctgggcgcgcgccgcgacttctccagcgtgcccgccagctat
tggtgggccgtcatctccatgaccaccgtgggctacggcgacatggtcccgcgcagcctg
cccgggcaggtggtggcgctcagcagcatcctcagcggcatcctgctcatggccttcccg
gtcacctccatcttccacaccttttcgcgctcctactccgagctcaaggagcagcagcag
cgcgcggccagccccgagccggccctgcaggaggacagcacgcactcggccacagccacc
gaggacagctcgcagggccccgacagcgcgggcctggccgacgactccgcggatgcgctg
tgggtgcgggcagggcgctga

DBGET integrated database retrieval system