KEGG   Homo sapiens (human): 26253Help
Entry
26253             CDS       T01001                                 

Gene name
CLEC4E, CLECSF9, MINCLE
Definition
C-type lectin domain family 4, member E
Orthology
K10059  
C-type lectin domain family 4 member E
Organism
hsa  Homo sapiens (human)
Pathway
Tuberculosis
Class
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 219 aa AA seqDB search
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLP
ENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS
QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCA
TMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatctaaatcatctgaaacacaatgcacagagagaggatgcttctcttcccaa
atgttcttatggactgttgctgggatccccatcctatttctcagtgcctgtttcatcacc
agatgtgttgtgacatttcgcatctttcaaacctgtgatgagaaaaagtttcagctacct
gagaatttcacagagctctcctgctacaattatggatcaggttcagtcaagaattgttgt
ccattgaactgggaatattttcaatccagctgctacttcttttctactgacaccatttcc
tgggcgttaagtttaaagaactgctcagccatgggggctcacctggtggttatcaactca
caggaggagcaggaattcctttcctacaagaaacctaaaatgagagagttttttattgga
ctgtcagaccaggttgtcgagggtcagtggcaatgggtggacggcacacctttgacaaag
tctctgagcttctgggatgtaggggagcccaacaacatagctaccctggaggactgtgcc
accatgagagactcttcaaacccaaggcaaaattggaatgatgtaacctgtttcctcaat
tattttcggatttgtgaaatggtaggaataaatcctttgaacaaaggaaaatctctttaa

DBGET integrated database retrieval system