KEGG   Homo sapiens (human): 26259Help
Entry
26259             CDS       T01001                                 

Gene name
FBXW8, FBW6, FBW8, FBX29, FBXO29, FBXW6
Definition
(RefSeq) F-box and WD repeat domain containing 8
  KO
K10264  
F-box and WD-40 domain protein 8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26259 (FBXW8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26259 (FBXW8)
   Cul7 complex
    Target recognizing subunit
     26259 (FBXW8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.22
AA seq 598 aa AA seqDB search
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLL
EGAGRPPAARATRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLP
YELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLI
FQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTW
DYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDA
RIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVA
VAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLE
AGRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSA
VQMDDWKIVSGGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRN
ADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggacgactacagcctggatgagttccgtcggcgctggcaggaggagctggcgcaggcc
caggcgccgaagaagcggcgacggcccgaggctgccgagaggcgggctcggcggccggag
gtgggctccgggcgcggcgaacaggcctcgggggacccggcgctggcccagcgtctcctg
gagggcgcggggaggcccccggcggcgcgggcgactcgggccgaggggcaggacgtagcg
agccgctcacgttctcctctggcccgcgagggcgccgggggcggggagcagctggtggac
cagctcatccgcgacctgaatgaaatgaatgatgtgcctttctttgatatccaactgcct
tacgaattggcaatcaatatatttcagtatctggacaggaaagaactaggaagatgtgca
caggtgagcaagacgtggaaggtgattgcagaggatgaggtgctgtggtacaggctgtgc
cagcaggaagggcaccttccggatagcagcatctctgactattcttgctggaagctcatc
ttccaagagtgccgagccaaggaacacatgttacgaaccaactggaagaatcgcaaaggt
gccgtgagcgagctggagcatgttcctgacacagttttgtgtgatgtgcattctcacgat
ggtgtggtcattgcgggatatacatcaggggatgtgagagtgtgggacacccgcacctgg
gactacgtagcccccttcctggaatcagaggacgaggaggatgagcctggaatgcagcca
aatgtctcctttgtgaggataaacagctcgttggcagtagcagcttatgaggatgggttt
cttaatatttgggatttaaggaccggaaagtaccctgttcatcgttttgagcacgatgca
agaatacaggcactagccctcagccaggacgatgcaaccgtggccacagcttctgctttt
gatgtcgtgatgttatcccccaatgaggaggggtactggcagatagctgcggaatttgaa
gttccgaaactggttcagtaccttgaaatagttccagaaaccagaaggtaccctgtggca
gtagccgctgctggagatctgatgtacctgctcaaagccgaagactccgccagaaccctc
ctttacgcccacggcccgcctgtcacatgtctagacgtctcggccaaccaagttgctttt
ggtgtacagggtctgggatgggtgtacgaaggaagcaagatcctggtgtatagcctggaa
gcaggacgccgcctcttgaagctgggtaacgttctccgtgacttcacgtgtgtcaacctc
agcgacagccctcccaacctcatggtcagtggcaacatggacgggagggtgaggatccac
gacctccgcagtggtaacatcgccctgtcgctctccgcccatcagctcagggtctctgct
gtgcagatggatgactggaagatcgtcagtggaggcgaggaaggcctggtgtccgtgtgg
gattatcggatgaaccagaagctgtgggaggtgtattccgggcacccggtgcagcacatc
tcattcagcagccacagcctcatcacggccaacgtgccttaccagacggtaatgcgaaac
gccgacctggacagcttcactactcacaggagacaccgggggctgatccgcgcctatgag
tttgcggtggaccagctggccttccagagccctctccctgtctgccgttcatcctgtgac
gccatggccactcactactacgacctcgcactggcctttccctataaccatgtttag

DBGET integrated database retrieval system