KEGG   Homo sapiens (human): 26259Help
Entry
26259             CDS       T01001                                 

Gene name
FBXW8, FBW6, FBW8, FBX29, FBXO29, FBXW6
Definition
F-box and WD repeat domain containing 8
Orthology
K10264  
F-box and WD-40 domain protein 8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.22
AA seq 532 aa AA seqDB search
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPENEMNDVPFFDIQLPYELAIN
IFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQECRA
KEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPF
LESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDARIQALA
LSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGD
LMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLEAGRRLL
KLGNVLRDFTCVNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSAVQMDDW
KIVSGGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSF
TTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggacgactacagcctggatgagttccgtcggcgctggcaggaggagctggcgcaggcc
caggcgccgaagaagcggcgacggcccgaggctgccgagaggcgggctcggcggccggag
aatgaaatgaatgatgtgcctttctttgatatccaactgccttacgaattggcaatcaat
atatttcagtatctggacaggaaagaactaggaagatgtgcacaggtgagcaagacgtgg
aaggtgattgcagaggatgaggtgctgtggtacaggctgtgccagcaggaagggcacctt
ccggatagcagcatctctgactattcttgctggaagctcatcttccaagagtgccgagcc
aaggaacacatgttacgaaccaactggaagaatcgcaaaggtgccgtgagcgagctggag
catgttcctgacacagttttgtgtgatgtgcattctcacgatggtgtggtcattgcggga
tatacatcaggggatgtgagagtgtgggacacccgcacctgggactacgtagcccccttc
ctggaatcagaggacgaggaggatgagcctggaatgcagccaaatgtctcctttgtgagg
ataaacagctcgttggcagtagcagcttatgaggatgggtttcttaatatttgggattta
aggaccggaaagtaccctgttcatcgttttgagcacgatgcaagaatacaggcactagcc
ctcagccaggacgatgcaaccgtggccacagcttctgcttttgatgtcgtgatgttatcc
cccaatgaggaggggtactggcagatagctgcggaatttgaagttccgaaactggttcag
taccttgaaatagttccagaaaccagaaggtaccctgtggcagtagccgctgctggagat
ctgatgtacctgctcaaagccgaagactccgccagaaccctcctttacgcccacggcccg
cctgtcacatgtctagacgtctcggccaaccaagttgcttttggtgtacagggtctggga
tgggtgtacgaaggaagcaagatcctggtgtatagcctggaagcaggacgccgcctcttg
aagctgggtaacgttctccgtgacttcacgtgtgtcaacctcagcgacagccctcccaac
ctcatggtcagtggcaacatggacgggagggtgaggatccacgacctccgcagtggtaac
atcgccctgtcgctctccgcccatcagctcagggtctctgctgtgcagatggatgactgg
aagatcgtcagtggaggcgaggaaggcctggtgtccgtgtgggattatcggatgaaccag
aagctgtgggaggtgtattccgggcacccggtgcagcacatctcattcagcagccacagc
ctcatcacggccaacgtgccttaccagacggtaatgcgaaacgccgacctggacagcttc
actactcacaggagacaccgggggctgatccgcgcctatgagtttgcggtggaccagctg
gccttccagagccctctccctgtctgccgttcatcctgtgacgccatggccactcactac
tacgacctcgcactggcctttccctataaccatgtttag

DBGET integrated database retrieval system