KEGG   Homo sapiens (human): 2626Help
Entry
2626              CDS       T01001                                 

Gene name
GATA4, ASD2, TACHD, TOF, VSD1
Definition
(RefSeq) GATA binding protein 4
  KO
K09183  GATA-binding protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04218  Cellular senescence
hsa04530  Tight junction
hsa04919  Thyroid hormone signaling pathway
Disease
H00546  Atrial septal defect
H00547  Atrioventricular septal defect
H00549  Tetralogy of Fallot
H01926  Ventricular septal defect (VSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    2626 (GATA4)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    2626 (GATA4)
  Cellular community - eukaryotes
   04530 Tight junction
    2626 (GATA4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    2626 (GATA4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    2626 (GATA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap Prim_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 2626
NCBI-ProteinID: NP_002043
OMIM: 600576
HGNC: 4173
Ensembl: ENSG00000136574
Vega: OTTHUMG00000090800
Pharos: P43694(Tbio)
UniProt: P43694 B3KUF4
Structure
PDB: 

Jmol
Position
8p23.1
AA seq 442 aa AA seqDB search
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT
SSKQDSWNSLVLADSHGDIITA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagagcttggccatggccgccaaccacgggccgccccccggtgcctacgaggcg
ggcggccccggcgccttcatgcacggcgcgggcgccgcgtcctcgccagtctacgtgccc
acaccgcgggtgccctcctccgtgctgggcctgtcctacctccagggcggaggcgcgggc
tctgcgtccggaggcgcctcgggcggcagctccggtggggccgcgtctggtgcggggccc
gggacccagcagggcagcccgggatggagccaggcgggagccgacggagccgcttacacc
ccgccgccggtgtcgccgcgcttctccttcccggggaccaccgggtccctggcggccgcc
gccgccgctgccgcggcccgggaagctgcggcctacagcagtggcggcggagcggcgggt
gcgggcctggcgggccgcgagcagtacgggcgcgccggcttcgcgggctcctactccagc
ccctacccggcttacatggccgacgtgggcgcgtcctgggccgcagccgccgccgcctcc
gccggccccttcgacagcccggtcctgcacagcctgcccggccgggccaacccggccgcc
cgacaccccaatctcgatatgtttgacgacttctcagaaggcagagagtgtgtcaactgt
ggggctatgtccaccccgctctggaggcgagatgggacgggtcactatctgtgcaacgcc
tgcggcctctaccacaagatgaacggcatcaaccggccgctcatcaagcctcagcgccgg
ctgtccgcctcccgccgagtgggcctctcctgtgccaactgccagaccaccaccaccacg
ctgtggcgccgcaatgcggagggcgagcctgtgtgcaatgcctgcggcctctacatgaag
ctccacggggtccccaggcctcttgcaatgcggaaagaggggatccaaaccagaaaacgg
aagcccaagaacctgaataaatctaagacaccagcagctccttcaggcagtgagagcctt
cctcccgccagcggtgcttccagcaactccagcaacgccaccaccagcagcagcgaggag
atgcgtcccatcaagacggagcctggcctgtcatctcactacgggcacagcagctccgtg
tcccagacgttctcagtcagtgcgatgtctggccatgggccctccatccaccctgtcctc
tcggccctgaagctctccccacaaggctatgcgtctcccgtcagccagtctccacagacc
agctccaagcaggactcttggaacagcctggtcttggccgacagtcacggggacataatc
actgcgtaa

DBGET integrated database retrieval system