KEGG   Homo sapiens (human): 2626Help
Entry
2626              CDS       T01001                                 

Gene name
GATA4, ASD2, TACHD, TOF, VSD1
Definition
(RefSeq) GATA binding protein 4
  KO
K09183  
GATA-binding protein 4
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Thyroid hormone signaling pathway
Disease
H00546  
Atrial septal defect
H00547  
Atrioventricular septal defect
H00549  
Tetralogy of Fallot
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    2626 (GATA4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    2626 (GATA4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    2626 (GATA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p23.1-p22
AA seq 442 aa AA seqDB search
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT
SSKQDSWNSLVLADSHGDIITA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagagcttggccatggccgccaaccacgggccgccccccggtgcctacgaggcg
ggcggccccggcgccttcatgcacggcgcgggcgccgcgtcctcgccagtctacgtgccc
acaccgcgggtgccctcctccgtgctgggcctgtcctacctccagggcggaggcgcgggc
tctgcgtccggaggcgcctcgggcggcagctccggtggggccgcgtctggtgcggggccc
gggacccagcagggcagcccgggatggagccaggcgggagccgacggagccgcttacacc
ccgccgccggtgtcgccgcgcttctccttcccggggaccaccgggtccctggcggccgcc
gccgccgctgccgcggcccgggaagctgcggcctacagcagtggcggcggagcggcgggt
gcgggcctggcgggccgcgagcagtacgggcgcgccggcttcgcgggctcctactccagc
ccctacccggcttacatggccgacgtgggcgcgtcctgggccgcagccgccgccgcctcc
gccggccccttcgacagcccggtcctgcacagcctgcccggccgggccaacccggccgcc
cgacaccccaatctcgatatgtttgacgacttctcagaaggcagagagtgtgtcaactgt
ggggctatgtccaccccgctctggaggcgagatgggacgggtcactatctgtgcaacgcc
tgcggcctctaccacaagatgaacggcatcaaccggccgctcatcaagcctcagcgccgg
ctgtccgcctcccgccgagtgggcctctcctgtgccaactgccagaccaccaccaccacg
ctgtggcgccgcaatgcggagggcgagcctgtgtgcaatgcctgcggcctctacatgaag
ctccacggggtccccaggcctcttgcaatgcggaaagaggggatccaaaccagaaaacgg
aagcccaagaacctgaataaatctaagacaccagcagctccttcaggcagtgagagcctt
cctcccgccagcggtgcttccagcaactccagcaacgccaccaccagcagcagcgaggag
atgcgtcccatcaagacggagcctggcctgtcatctcactacgggcacagcagctccgtg
tcccagacgttctcagtcagtgcgatgtctggccatgggccctccatccaccctgtcctc
tcggccctgaagctctccccacaaggctatgcgtctcccgtcagccagtctccacagacc
agctccaagcaggactcttggaacagcctggtcttggccgacagtcacggggacataatc
actgcgtaa

DBGET integrated database retrieval system