KEGG   Homo sapiens (human): 2627Help
Entry
2627              CDS       T01001                                 

Gene name
GATA6
Definition
GATA binding protein 6
Orthology
K17897  
GATA-binding protein 6
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q11.1-q11.2
AA seq 595 aa AA seqDB search
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGG
AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL
AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH
SLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRP
LAMKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASG
AGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggccttgactgacggcggctggtgcttgccgaagcgcttcggggccgcgggtgcggac
gccagcgactccagagcctttccagcgcgggagccctccacgccgccttcccccatctct
tcctcgtcctcctcctgctcccggggcggagagcggggccccggcggcgccagcaactgc
gggacgcctcagctcgacacggaggcggcggccggacccccggcccgctcgctgctgctc
agttcctacgcttcgcatcccttcggggctccccacggaccttcggcgcctggggtcgcg
ggccccgggggcaacctgtcgagctgggaggacttgctgctgttcactgacctcgaccaa
gccgcgaccgccagcaagctgctgtggtccagccgcggcgccaagctgagccccttcgca
cccgagcagccggaggagatgtaccagaccctcgccgctctctccagccagggtccggcc
gcctacgacggcgcgcccggcggcttcgtgcactctgcggccgcggcggcagcagccgcg
gcggcggccagctccccggtctacgtgcccaccacccgcgtgggttccatgctgcccggc
ctaccgtaccacctgcaggggtcgggcagtgggccagccaaccacgcgggcggcgcgggc
gcgcaccccggctggcctcaggcctcggccgacagccctccatacggcagcggaggcggc
gcggctggcggcggggccgcggggcctggcggcgctggctcagccgcggcgcacgtctcg
gcgcgcttcccctactctcccagcccgcccatggccaacggcgccgcgcgggagccggga
ggctacgcggcggcgggcagtgggggcgcgggaggcgtgagcggcggcggcagtagcctg
gcggccatgggcggccgcgagccccagtacagctcgctgtcggccgcgcggccgctgaac
gggacgtaccaccaccaccaccaccaccaccaccaccatccgagcccctactcgccctac
gtgggggcgccactgacgcctgcctggcccgccggacccttcgagaccccggtgctgcac
agcctgcagagccgcgccggagccccgctcccggtgccccggggtcccagtgcagacctg
ctggaggacctgtccgagagccgcgagtgcgtgaactgcggctccatccagacgccgctg
tggcggcgggacggcaccggccactacctgtgcaacgcctgcgggctctacagcaagatg
aacggcctcagccggcccctcatcaagccgcagaagcgcgtgccttcatcacggcggctt
ggattgtcctgtgccaactgtcacaccacaactaccaccttatggcgcagaaacgccgag
ggtgaacccgtgtgcaatgcttgtggactctacatgaaactccatggggtgcccagacca
cttgctatgaaaaaagagggaattcaaaccaggaaacgaaaacctaagaacataaataaa
tcaaagacttgctctggtaatagcaataattccattcccatgactccaacttccacctct
tctaactcagatgattgcagcaaaaatacttcccccacaacacaacctacagcctcaggg
gcgggtgccccggtgatgactggtgcgggagagagcaccaatcccgagaacagcgagctc
aagtattcgggtcaagatgggctctacataggcgtcagtctcgcctcgccggccgaagtc
acgtcctccgtgcgaccggattcctggtgcgccctggccctggcctga

DBGET integrated database retrieval system