KEGG   Homo sapiens (human): 26272Help
Entry
26272             CDS       T01001                                 

Gene name
FBXO4, FBX4
Definition
F-box protein 4
Orthology
K10291  
F-box protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26272 (FBXO4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     26272 (FBXO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p12
AA seq 387 aa AA seqDB search
MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT
RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQ
DTEAETLTGFLNGIEWILEEVESKRAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagcgagccgcgcagcggaacaaactcgccgccgccgcccttcagcgactgg
ggccgcctggaggcggccatcctcagcggctggaagaccttctggcagtcagtgagcaag
gagagggtggcgcgtacgacctcacgggaggaggtggatgaggcggccagcaccctgacg
cggctgccgattgatgtacagctatatattttgtcctttctttcacctcatgatctgtgt
cagttgggaagtacaaatcattattggaatgaaactgtaagagatccaattctgtggaga
tactttttgttgagggatcttccttcttggtcttctgttgactggaagtctcttccagat
ctagaaatcttaaaaaagcctatatctgaggtcactgatggtgcattttttgactacatg
gcagtctatagaatgtgctgtccatacacaagaagagcttcaaaatccagccgtcctatg
tatggagctgtcacttcttttttacactccctgatcattcagaatgaaccacgatttgct
atgtttggaccaggtttggaagaattgaatacctctttggtgttgagcttgatgtcttca
gaggaactttgcccaacagctggtttgcctcagaggcagattgatggtattggatcagga
gtcaattttcagttgaacaaccaacataaattcaacattctaatcttatattcaactacc
agaaaggaaagagatagagcaagggaagagcatacaagtgcagttaacaagatgttcagt
cgacacaatgaaggtgatgatcaacaaggaagccggtacagtgtgattccacagattcaa
aaagtgtgtgaagttgtagatgggttcatctatgttgcaaatgctgaagctcataaaaga
catgaatggcaagatgaattttctcatattatggcaatgacagatccagcctttgggtct
tcgggaagaccattgttggttttatcttgtatttctcaaggggatgtaaaaagaatgccc
tgtttttatttggctcatgagctgcatctgaatcttctaaatcacccatggctggtccag
gatacagaggctgaaactctgactggttttttgaatggcattgagtggattcttgaagaa
gtggaatctaagcgtgcaagatga

DBGET integrated database retrieval system