KEGG   Homo sapiens (human): 26275Help
Entry
26275             CDS       T01001                                 

Gene name
HIBCH, HIBYLCOAH
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Disease
H01349  
Methacrylic aciduria
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q32.2
AA seq 386 aa AA seqDB search
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgcgagatgtggaggctcatgtcgaggtttaatgcattcaaaaggactaat
accatactgcaccatttgagaatgtccaagcacacagatgcagcagaagaggtgctattg
gaaaaaaaaggttgcacgggagtcataacactaaacagaccaaagttcctcaatgcactg
actcttaatatgattcggcagatttatccacagctaaagaagtgggaacaagatcctgaa
actttcctgatcattataaagggagcaggaggaaaggctttctgtgccgggggtgatatc
agagtgatctcggaagctgaaaaggcaaaacagaagatagctccagttttcttcagagaa
gaatatatgctgaataatgctgttggttcttgccagaaaccttatgttgcacttattcat
ggaattacaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctaca
gaaaagtgtctttttgctatgccagaaactgcaataggactgttccctgatgtgggtgga
ggttatttcttgccacgactccaaggaaaacttggttacttccttgcattaacaggattc
agactaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaa
aagttggccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatatt
gcatctgtcttagaaaattaccatacagagtctaagattgatcgagacaagtcttttata
cttgaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaagaaatt
attgaaaacttacagcaagatggttcatcttttgccctagagcaattgaaggtaattaat
aaaatgtctccaacatctctaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgcaagaagtactaactatggagtatcggctaagtcaagcttgtatgagaggtcat
gactttcatgaaggcgttagagctgttttaattgataaagaccagagtccaaaatggaaa
ccagctgatctaaaagaagttactgaggaagatttgaataatcactttaagtctttggga
agcagtgatttgaaattttga

DBGET integrated database retrieval system