KEGG   Homo sapiens (human): 26275Help
Entry
26275             CDS       T01001                                 

Gene name
HIBCH, HIBYLCOAH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00410  beta-Alanine metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Disease
H01349  Methacrylic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    26275 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    26275 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    26275 (HIBCH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     26275 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 DUF4600
Motif
Other DBs
NCBI-GeneID: 26275
NCBI-ProteinID: NP_055177
OMIM: 610690
HGNC: 4908
Ensembl: ENSG00000198130
Vega: OTTHUMG00000132673
Pharos: Q6NVY1(Tbio)
UniProt: Q6NVY1 A0A140VJL0
Structure
PDB: 

Jmol
Position
2q32.2
AA seq 386 aa AA seqDB search
MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNAL
TLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTEEDLNNHFKSLGSSDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgcgagatgtggaggctcatgtcgaggtttaatgcattcaaaaggactaat
accatactgcaccatttgagaatgtccaagcacacagatgcagcagaagaggtgctattg
gaaaaaaaaggttgcacgggagtcataacactaaacagaccaaagttcctcaatgcactg
actcttaatatgattcggcagatttatccacagctaaagaagtgggaacaagatcctgaa
actttcctgatcattataaagggagcaggaggaaaggctttctgtgccgggggtgatatc
agagtgatctcggaagctgaaaaggcaaaacagaagatagctccagttttcttcagagaa
gaatatatgctgaataatgctgttggttcttgccagaaaccttatgttgcacttattcat
ggaattacaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctaca
gaaaagtgtctttttgctatgccagaaactgcaataggactgttccctgatgtgggtgga
ggttatttcttgccacgactccaaggaaaacttggttacttccttgcattaacaggattc
agactaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaa
aagttggccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatatt
gcatctgtcttagaaaattaccatacagagtctaagattgatcgagacaagtcttttata
cttgaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaagaaatt
attgaaaacttacagcaagatggttcatcttttgccctagagcaattgaaggtaattaat
aaaatgtctccaacatctctaaagatcacactaaggcaactcatggaggggtcttcaaag
accttgcaagaagtactaactatggagtatcggctaagtcaagcttgtatgagaggtcat
gactttcatgaaggcgttagagctgttttaattgataaagaccagagtccaaaatggaaa
ccagctgatctaaaagaagttactgaggaagatttgaataatcactttaagtctttggga
agcagtgatttgaaattttga

DBGET integrated database retrieval system