KEGG   Homo sapiens (human): 26291Help
Entry
26291             CDS       T01001                                 

Gene name
FGF21
Definition
fibroblast growth factor 21
Orthology
K04358  
fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26291 (FGF21)
   04015 Rap1 signaling pathway
    26291 (FGF21)
   04010 MAPK signaling pathway
    26291 (FGF21)
   04151 PI3K-Akt signaling pathway
    26291 (FGF21)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    26291 (FGF21)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    26291 (FGF21)
   05205 Proteoglycans in cancer
    26291 (FGF21)
   05218 Melanoma
    26291 (FGF21)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  26291 (FGF21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 209 aa AA seqDB search
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacgagaccgggttcgagcactcaggactgtgggtttctgtgctggctggt
cttctgctgggagcctgccaggcacaccccatccctgactccagtcctctcctgcaattc
gggggccaagtccggcagcggtacctctacacagatgatgcccagcagacagaagcccac
ctggagatcagggaggatgggacggtggggggcgctgctgaccagagccccgaaagtctc
ctgcagctgaaagccttgaagccgggagttattcaaatcttgggagtcaagacatccagg
ttcctgtgccagcggccagatggggccctgtatggatcgctccactttgaccctgaggcc
tgcagcttccgggagctgcttcttgaggacggatacaatgtttaccagtccgaagcccac
ggcctcccgctgcacctgccagggaacaagtccccacaccgggaccctgcaccccgagga
ccagctcgcttcctgccactaccaggcctgccccccgcactcccggagccacccggaatc
ctggccccccagccccccgatgtgggctcctcggaccctctgagcatggtgggaccttcc
cagggccgaagccccagctacgcttcctga

DBGET integrated database retrieval system