KEGG   Homo sapiens (human): 26298Help
Entry
26298             CDS       T01001                                 

Gene name
EHF, ESE3, ESE3B, ESEJ
Definition
(RefSeq) ETS homologous factor
  KO
K17102  ETS homologous factor
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    26298 (EHF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT MVL
Motif
Other DBs
NCBI-GeneID: 26298
NCBI-ProteinID: NP_036285
OMIM: 605439
HGNC: 3246
Ensembl: ENSG00000135373
Vega: OTTHUMG00000166454
Pharos: Q9NZC4(Tbio)
UniProt: Q9NZC4
Position
11p13
AA seq 300 aa AA seqDB search
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSD
LFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLP
VAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFL
KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattctggaaggaggtggtgtaatgaatctcaaccccggcaacaacctccttcaccag
ccgccagcctggacagacagctactccacgtgcaatgtttccagtgggttttttggaggc
cagtggcatgaaattcatcctcagtactggaccaagtaccaggtgtgggagtggctccag
cacctcctggacaccaaccagctggatgccaattgtatccctttccaagagttcgacatc
aacggcgagcacctctgcagcatgagtttgcaggagttcacccgggcggcagggacggcg
gggcagctcctctacagcaacttgcagcatctgaagtggaacggccagtgcagtagtgac
ctgttccagtccacacacaatgtcattgtcaagactgaacaaactgagccttccatcatg
aacacctggaaagacgagaactatttatatgacaccaactatggtagcacagtagatttg
ttggacagcaaaactttctgccgggctcagatctccatgacaaccaccagtcaccttcct
gttgcagagtcacctgatatgaaaaaggagcaagacccccctgccaagtgccacaccaaa
aagcacaacccgagagggactcacttatgggaattcatccgcgacatcctcttgaaccca
gacaagaacccaggattaataaaatgggaagaccgatctgagggcgtcttcaggttcttg
aaatcagaggcagtggctcagctatggggtaaaaagaagaacaacagcagcatgacctat
gaaaagctcagccgagctatgagatattactacaaaagagaaattctggagcgtgtggat
ggacgaagactggtatataaatttgggaagaatgcccgaggatggagagaaaatgaaaac
tga

DBGET integrated database retrieval system