KEGG   Homo sapiens (human): 26298Help
Entry
26298             CDS       T01001                                 

Gene name
EHF, ESE3, ESE3B, ESEJ
Definition
(RefSeq) ETS homologous factor
  KO
K17102  
ETS homologous factor
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    26298 (EHF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11p12
AA seq 300 aa AA seqDB search
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSD
LFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLP
VAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFL
KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattctggaaggaggtggtgtaatgaatctcaaccccggcaacaacctccttcaccag
ccgccagcctggacagacagctactccacgtgcaatgtttccagtgggttttttggaggc
cagtggcatgaaattcatcctcagtactggaccaagtaccaggtgtgggagtggctccag
cacctcctggacaccaaccagctggatgccaattgtatccctttccaagagttcgacatc
aacggcgagcacctctgcagcatgagtttgcaggagttcacccgggcggcagggacggcg
gggcagctcctctacagcaacttgcagcatctgaagtggaacggccagtgcagtagtgac
ctgttccagtccacacacaatgtcattgtcaagactgaacaaactgagccttccatcatg
aacacctggaaagacgagaactatttatatgacaccaactatggtagcacagtagatttg
ttggacagcaaaactttctgccgggctcagatctccatgacaaccaccagtcaccttcct
gttgcagagtcacctgatatgaaaaaggagcaagacccccctgccaagtgccacaccaaa
aagcacaacccgagagggactcacttatgggaattcatccgcgacatcctcttgaaccca
gacaagaacccaggattaataaaatgggaagaccgatctgagggcgtcttcaggttcttg
aaatcagaggcagtggctcagctatggggtaaaaagaagaacaacagcagcatgacctat
gaaaagctcagccgagctatgagatattactacaaaagagaaattctggagcgtgtggat
ggacgaagactggtatataaatttgggaagaatgcccgaggatggagagaaaatgaaaac
tga

DBGET integrated database retrieval system