KEGG   Homo sapiens (human): 26330Help
Entry
26330             CDS       T01001                                 

Gene name
GAPDHS, GAPD2, GAPDH-2, GAPDS, HEL-S-278, HSD-35
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
  KO
K10705  
glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [EC:1.2.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    26330 (GAPDHS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     26330 (GAPDHS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14556(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.12
AA seq 408 aa AA seqDB search
MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPP
HPATPPPKMVSVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKY
DSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAAS
DHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERF
GIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKL
TGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLG
DTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcgcgacatcgtcctcaccaatgtcaccgttgtccagttgctgcgacagccg
tgcccggtgaccagagcaccgcccccacctgagcctaaggctgaagtagagccccagcca
caaccagagcccacaccagtcagggaggaaataaagccaccaccgccaccactgcctcct
caccccgctactcctcctcctaagatggtgtctgtggcccgggagctgactgtgggcatc
aatggatttggacgcatcggtcgcctggtcctgcgcgcctgcatggagaagggtgttaag
gtggtggctgtgaatgatccattcattgacccggaatacatggtgtacatgtttaagtat
gactccacccacggccgatacaagggaagtgtggaattcaggaatggacaactggtcgtg
gacaaccatgagatctctgtctaccagtgcaaagagcccaaacagatcccctggagggct
gtcgggagcccctacgtggtggagtccacaggcgtgtacctctccatacaggcagcttcg
gaccacatctctgcaggtgctcaacgtgtggtcatctccgcgccctcaccggatgcacca
atgttcgtcatgggtgtcaatgaaaatgactataaccctggctccatgaacattgtgagc
aacgcgtcctgcaccaccaactgtttggctcccctcgccaaagtcatccacgagcgattt
gggatcgtggaagggttgatgaccacagtccattcctacacggccacccagaagacagtg
gacgggccatcaaggaaggcctggcgagatgggcggggtgcccaccagaacatcatccca
gcctccactggggctgcgaaagctgtgaccaaagtcatcccagagctcaaagggaagctg
acagggatggcgttccgggtaccaaccccggatgtgtctgtcgtggacctgacctgccgc
ctcgcccagcctgccccctactcagccatcaaggaggctgtaaaagcagcagccaagggg
cccatggctggcatccttgcctacaccgaggatgaggtcgtctctacggacttcctcggt
gatacccactcgtccatcttcgatgctaaggccggcattgcgctcaatgacaatttcgtg
aagctcatttcatggtacgacaacgaatatggctacagtcaccgggtggtcgacctcctc
cgctacatgttcagccgagacaagtga

DBGET integrated database retrieval system