KEGG   Homo sapiens (human): 26354Help
Entry
26354             CDS       T01001                                 

Gene name
GNL3, C77032, E2IG3, NNP47, NS
Definition
(RefSeq) G protein nucleolar 3
  KO
K14538  
nuclear GTP-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    26354 (GNL3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    26354 (GNL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BVP2(Tbio)
UniProt: 
Position
3p21.1
AA seq 549 aa AA seqDB search
MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEAL
LREAELRKQRLEELKQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAK
SGKQNSKKLYCQELKKVIEASDVVLEVLDARDPLGCRCPQVEEAIVQSGQKKLVLILNKS
DLVPKENLESWLNYLKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPFRSEVCFGKEGL
WKLLGGFQETCSKAIRVGVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPLDKQ
ITIIDSPSFIVSPLNSSSALALRSPASIEVVKPMEAASAILSQADARQVVLKYTVPGYRN
SLEFFTVLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIV
VDMKSGFNLEELEKNNAQSIRAIKGPHLANSILFQSSGLTNGIIEEKDIHEELPKRKERK
QEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTRSFILDKIIEEDD
AYDFSTDYV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggcctaagttaaagaaagcaagtaaacgcatgacctgccataagcggtataaa
atccaaaaaaaggttcgagaacatcatcgaaaattaagaaaggaggctaaaaagcggggt
cacaagaagcctaggaaagacccaggagttccaaacagtgctccctttaaggaggctctt
cttagggaagctgagctaaggaaacagaggcttgaagaactaaaacagcagcagaaactt
gacaggcagaaggaactagaaaagaaaagaaaacttgaaactaatcctgatattaagcca
tcaaatgtggaacctatggaaaaggagtttgggctttgcaaaactgagaacaaagccaag
tcgggcaaacagaattcaaagaagctgtactgccaagaacttaaaaaggtgattgaagcc
tccgatgttgtcctagaggtgttggatgccagagatcctcttggttgcagatgtcctcag
gtagaagaggccattgtccagagtggacagaaaaagctggtacttatattaaataaatca
gatctggtaccaaaggagaatttggagagctggctaaattatttgaagaaagaattgcca
acagtggtgttcagagcctcaacaaaaccaaaggataaagggaagataaccaagcgtgtg
aaggcaaagaagaatgctgctccattcagaagtgaagtctgctttgggaaagagggcctt
tggaaacttcttggaggttttcaggaaacttgcagcaaagccattcgggttggagtaatt
ggtttcccaaatgtggggaaaagcagcattatcaatagcttaaaacaagaacagatgtgt
aatgttggtgtatccatggggcttacaaggagcatgcaagttgtccccttggacaaacag
atcacaatcatagatagtccgagcttcatcgtatctccacttaattcctcctctgcgctt
gctctgcgaagtccagcaagtattgaagtagtaaaaccgatggaggctgccagtgccatc
ctttcccaggctgatgctcgacaggtagtactgaaatatactgtcccaggctacaggaat
tctctggaattttttactgtgcttgctcagagaagaggtatgcaccaaaaaggtggaatc
ccaaatgttgaaggtgctgccaaactgctgtggtctgagtggacaggtgcctcattagct
tactattgccatccccctacatcttggactcctcctccatattttaatgagagtattgtg
gtagacatgaaaagcggcttcaatctggaagaactggaaaagaacaatgcacagagcata
agagccatcaagggccctcatttggccaatagcatccttttccagtcttccggtctgaca
aatggaataatagaagaaaaggacatacatgaagaattgccaaaacggaaagaaaggaag
caggaggagagggaggatgacaaagacagtgaccaggaaactgttgatgaagaagttgat
gaaaacagctcaggcatgtttgctgcagaagagacaggggaggcactgtctgaggagact
acagcaggtgaacagtctacaaggtcttttatcttggataaaatcattgaagaggatgat
gcttatgacttcagtacagattatgtgtaa

DBGET integrated database retrieval system