KEGG   Homo sapiens (human): 2648Help
Entry
2648              CDS       T01001                                 

Gene name
KAT2A, GCN5, GCN5L2, PCAF-b, hGCN5
Definition
K(lysine) acetyltransferase 2A (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    2648 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    2648 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2648 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    2648 (KAT2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     2648 (KAT2A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     2648 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21
AA seq 837 aa AA seqDB search
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccgaccccggccccggctgcgcagccccggccccttcag
tccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccgattccg
actcccaccccggcaccagcccctgccccagctgcagccccagccggcagcacagggact
ggggggcccggggtaggaagtgggggggccgggagcgggggggatccggctcgacctggc
ctgagccagcagcagcgcgccagtcagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcagcagccagct
gccaacctgagtgagctgtgccgcagttgtgagcaccccttggctgaccacgtatcccac
ttggagaatgtgtcagaggatgagataaaccgactgctggggatggtggtggatgtggag
aatctcttcatgtctgttcacaaggaagaggacacagacaccaagcaggtctatttctac
ctcttcaagctactgcggaaatgcatcctgcagatgacccggcctgtggtggaggggtcc
ctgggcagccctccatttgagaaacctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacgatgttcgagctctcaaagatg
ttcttgctctgccttaactactggaagcttgagacacctgcccagtttcggcagaggtct
caggctgaggacgtggctacctacaaggtcaattacaccagatggctctgttactgccac
gtgccccagagctgtgatagcctcccccgctacgaaaccactcatgtctttgggcgaagc
cttctccggtccattttcaccgttacccgccggcagctgctggaaaagttccgagtggag
aaggacaaattggtgcccgagaagaggaccctcatcctcactcacttccccaaattcctg
tccatgctggaggaggagatctatggggcaaactctccaatctgggagtcaggcttcacc
atgccaccctcagaggggacacagctggttccccggccagcttcagtcagtgcagcggtt
gttcccagcacccccatcttcagccccagcatgggtgggggcagcaacagctccctgagt
ctggattctgcaggggccgagcctatgccaggcgagaagaggacgctcccagagaacctg
accctggaggatgccaagcggctccgtgtgatgggtgacatccccatggagctggtcaat
gaggtcatgctgaccatcactgaccctgctgccatgctggggcctgagacgagcctgctt
tcggccaatgcggcccgggatgagacagcccgcctggaggagcgccgcggcatcatcgag
ttccatgtcatcggcaactcactgacgcccaaggccaaccggcgggtgttgctgtggctc
gtggggctgcagaatgtcttttcccaccagctgccgcgcatgcctaaggagtatatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtcatc
ggtggcatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctcgaatgagcaggtcaagggttatgggacccacctgatgaaccacctgaaggag
tatcacatcaagcacaacattctctacttcctcacctacgccgacgagtacgccatcggc
tacttcaaaaagcagggtttctccaaggacatcaaggtgcccaagagccgctacctgggc
tacatcaaggactacgagggagcgacgctgatggagtgtgagctgaatccccgcatcccc
tacacggagctgtcccacatcatcaagaagcagaaagagatcatcaagaagctgattgag
cgcaaacaggcccagatccgcaaggtctacccggggctcagctgcttcaaggagggcgtg
aggcagatccctgtggagagcgttcctggcattcgagagacaggctggaagccattgggg
aaggagaaggggaaggagctgaaggaccccgaccagctctacacaaccctcaaaaacctg
ctggcccaaatcaagtctcaccccagtgcctggcccttcatggagcctgtgaagaagtcg
gaggcccctgactactacgaggtcatccgcttccccattgacctgaagaccatgactgag
cggctgcgaagccgctactacgtgacccggaagctctttgtggccgacctgcagcgggtc
atcgccaactgtcgcgagtacaaccccccggacagcgagtactgccgctgtgccagcgcc
ctggagaagttcttctacttcaagctcaaggagggaggcctcattgacaagtag

DBGET integrated database retrieval system