KEGG   Homo sapiens (human): 2649Help
Entry
2649              CDS       T01001                                 

Gene name
NR6A1, CT150, GCNF, GCNF1, NR61, RTR, hGCNF, hRTR
Definition
(RefSeq) nuclear receptor subfamily 6 group A member 1
  KO
K08561  
germ cell nuclear factor
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 germ cell nuclear factor
    2649 (NR6A1)
Nuclear receptors [BR:hsa03310]
 6. Germ cell nuclear factor
  6A. Germ cell nuclear factor receptor
   2649 (NR6A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3
AA seq 480 aa AA seqDB search
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTISVSDDRAEQRTC
LICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKC
LQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSP
GNRASESNQPSPGSTLSSSRSVELNGFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLP
QQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAVTQAELFALLCRLADELLFRQIA
WIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHR
FSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWY
ICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggacgaaccgccgcctagcggagggggaggcggcgggggctcggcggggttc
ctggagcctcccgccgcgctccctccgccgccgcgcaacggtttctgtcaggatgaattg
gcagagcttgacccaggcactatttctgtttcagatgatcgggctgaacaacgaacctgt
ctcatttgtggggaccgcgctacaggcttgcactatgggatcatctcctgtgagggctgc
aaagggtttttcaagcggagcatttgcaacaaacgggtatatcgatgcagtcgtgacaag
aactgtgtcatgtctcggaagcagaggaacaggtgccagtactgccgcctgctcaaatgc
ctccagatggggatgaaccggaaggctatcagagaagatggcatgcctggaggccggaat
aagagcattgggccagtccagatatcggaagaagaaatcgaaaggatcatgtctgggcag
gagtttgaggaagaggccaatcactggagcaaccatggtgatagtgaccacagttcccct
gggaacagggcttcggagagcaaccagccctcaccaggctccacactgtcttccagtagg
tctgtggaactgaatggattcatggccttcagggaacagtacatgggaatgtctgtgcct
ccacattaccaatatataccgcacctttttagctattctggccactcaccacttctgccc
caacaagctcgcagcctggatccccagtcatacagtctgattcaccagctgttatcagcc
gaggacctggaaccattgggcacgcccatgttgattgaagatggatacgctgtgacacag
gcagaactatttgccctgctttgccgcctggccgacgagctgctctttaggcagattgcc
tggatcaagaaactgcctttcttctgcgagctctcaatcaaggattacacgtgcctcttg
agctctacgtggcaggagctaatcctgctgtcttccctcaccgtttacagcaagcagatc
tttggggaactggctgatgtcactgccaagtactcgccctccgatgaagaactacacaga
tttagtgatgaagggatggaggtgatcgagcggctcatctacctctatcacaagttccat
cagctaaaggtcagcaacgaggagtatgcttgcatgaaagcaattaacttcctaaatcaa
gatatcaggggtctgaccagtgcctcacagctggaacaattgaataaacgatactggtac
atttgccaggattttactgaatataaatacacacatcagccgaaccgctttcctgatctc
atgatgtgcttacctgagattcgatatattgcaggaaagatggtgaatgtgcccctggag
cagctgcccctcctctttaaggtggtgctgcattcctgcaagaccagtgtgggcaaggaa
tga

DBGET integrated database retrieval system