KEGG   Homo sapiens (human): 26492Help
Entry
26492             CDS       T01001                                 

Gene name
OR8G2, HSTPCR120, OR8G2P, OR8G4, ORL206, ORL486, TPCR120
Definition
olfactory receptor, family 8, subfamily G, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26492 (OR8G2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26492 (OR8G2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Position
11q24.2
AA seq 304 aa AA seqDB search
MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLFLLFLGIYVVTVVGNLSMIT
LIGLSSHLHTPMYYFLSGLSFIDLCHSTIITPKMLVNFVTEKNIISYPECMTQLYFFLIF
AIAECHMLAVTAYDRYVAICSPLLYNVIMSYHHCFWLTVGVYVLGILGSTIHTGFMLRLF
LCKTNVINHYFCDLFPLLGLSCSSTYINELLVLVLSAFNILTPALTILASYIFIIASILR
IRSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNP
QSIA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtttttctttcctccgtagaaactgaccaaaggaaaatgtcagcaggaaaccattcc
tcagtgactgagttcattctggctgggctctcagaacagccagagctccagctgcgcctc
ttcctcctgttcttaggaatctatgtggtcacagtggtgggcaacttgagcatgatcaca
ctgattgggctcagttctcacctgcatacccccatgtactatttcctcagtggtctgtcc
ttcattgatctctgccattccactatcattacccccaaaatgctggtgaactttgtgaca
gagaagaacatcatctcctaccctgaatgcatgactcagctttacttcttcctcattttt
gctattgcagagtgtcacatgttggctgtaacggcatatgaccgctatgttgccatctgc
agccccttgctgtacaatgtcatcatgtcctatcaccactgcttctggctcacagtggga
gtttacgttttaggcatccttggatctacaattcacaccggctttatgttgagactcttt
ttgtgcaagactaatgtgattaaccattatttttgtgatctcttccctctcttggggctc
tcctgctccagcacctacatcaatgaattactggttctggtcttgagtgcatttaacatc
ctgacgcctgccttaaccatccttgcttcttacatctttatcattgccagcatcctccgc
attcgctccactgagggcaggtccaaagccttcagcacttgcagctcccacatcttggct
gttgctgttttctttgggtctgcagcattcatgtacctgcagccatcatctgtcagctcc
atggaccagaggaaagtgtcctctgtgttttatactactattgtgcccatgctgaacccc
caatctatagcctaa

DBGET integrated database retrieval system