KEGG   Homo sapiens (human): 26492Help
Entry
26492             CDS       T01001                                 

Gene name
OR8G2P, HSTPCR120, OR8G2, OR8G4, ORL206, ORL486, TPCR120
Definition
(RefSeq) olfactory receptor family 8 subfamily G member 2 pseudogene
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26492 (OR8G2P)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26492 (OR8G2P)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26492
NCBI-ProteinID: NP_001278367
HGNC: 8485
Pharos: Q6IF36(Tdark)
UniProt: Q6IF36
Position
11q24.2
AA seq 304 aa AA seqDB search
MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLFLLFLGIYVVTVVGNLSMIT
LIGLSSHLHTPMYYFLSGLSFIDLCHSTIITPKMLVNFVTEKNIISYPECMTQLYFFLIF
AIAECHMLAVTAYDRYVAICSPLLYNVIMSYHHCFWLTVGVYVLGILGSTIHTGFMLRLF
LCKTNVINHYFCDLFPLLGLSCSSTYINELLVLVLSAFNILTPALTILASYIFIIASILR
IRSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNP
QSIA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggtttttctttcctccgtagaaactgaccaaaggaaaatgtcagcaggaaaccattcc
tcagtgactgagttcattctggctgggctctcagaacagccagagctccagctgcgcctc
ttcctcctgttcttaggaatctatgtggtcacagtggtgggcaacttgagcatgatcaca
ctgattgggctcagttctcacctgcatacccccatgtactatttcctcagtggtctgtcc
ttcattgatctctgccattccactatcattacccccaaaatgctggtgaactttgtgaca
gagaagaacatcatctcctaccctgaatgcatgactcagctttacttcttcctcattttt
gctattgcagagtgtcacatgttggctgtaacggcatatgaccgctatgttgccatctgc
agccccttgctgtacaatgtcatcatgtcctatcaccactgcttctggctcacagtggga
gtttacgttttaggcatccttggatctacaattcacaccggctttatgttgagactcttt
ttgtgcaagactaatgtgattaaccattatttttgtgatctcttccctctcttggggctc
tcctgctccagcacctacatcaatgaattactggttctggtcttgagtgcatttaacatc
ctgacgcctgccttaaccatccttgcttcttacatctttatcattgccagcatcctccgc
attcgctccactgagggcaggtccaaagccttcagcacttgcagctcccacatcttggct
gttgctgttttctttgggtctgcagcattcatgtacctgcagccatcatctgtcagctcc
atggaccagaggaaagtgtcctctgtgttttatactactattgtgcccatgctgaacccc
caatctatagcctaa

DBGET integrated database retrieval system