KEGG   Homo sapiens (human): 26493Help
Entry
26493             CDS       T01001                                 

Gene name
OR8B8, TPCR85
Definition
olfactory receptor, family 8, subfamily B, member 8
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26493 (OR8B8)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26493 (OR8B8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24.2
AA seq 311 aa AA seqDB search
MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMY
FFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAY
DRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCD
ILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFST
CSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVA
LKKILNKNAFS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgagaattcctccttcgtgacacagtttatcctcgcaggcttaactgaccaa
ccgggagtccagatccccctcttcttcctgtttctaggcttctacgtggtcactgtggtg
gggaacctgggcttgataaccctgataaggctcaactctcacttgcacacccctatgtac
ttcttcctctataacttgtccttcatagatttctgctattccagtgttatcactcccaaa
atgctgatgagctttgtcttaaagaagaacagcatctcctacgcagggtgtatgactcag
ctcttcttctttcttttctttgttgtctctgagtccttcatcctgtcagcaatggcgtat
gaccgctatgtggccatctgtaacccactgttgtacatggtcaccatgtctccccaggtg
tgttttctccttttgttgggtgtctatgggatggggtttgctggggccatggcccacaca
gcgtgcatgatgggtgtgaccttctgtgccaataaccttgtcaaccactacatgtgtgac
atccttccccttcttgagtgtgcttgcaccagcacctatgtgaatgagcttgtagtgttt
gttgttgtgggcattgatattggtgtgcccacagtcaccatcttcatttcctatgctctc
attctctccagcatcttccacattgattccacggagggcaggtccaaagccttcagcacc
tgcagctcccacataattgcagtttctctgttctttgggtcaggagcattcatgtacctc
aaacccttttctcttttagctatgaaccagggcaaggtgtcttccctattctataccact
gtggtgcccatgctcaacccattaatttatagcctgaggaataaggacgtcaaagttgct
ctaaagaaaatcttgaacaaaaatgcattctcctga

DBGET integrated database retrieval system