KEGG   Homo sapiens (human): 26524Help
Entry
26524             CDS       T01001                                 

Gene name
LATS2, KPM
Definition
(RefSeq) large tumor suppressor kinase 2 (EC:2.7.11.1)
  KO
K08791  
serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Hippo signaling pathway -multiple species
Module
Hippo signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    26524 (LATS2)
   04392 Hippo signaling pathway - multiple species
    26524 (LATS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     26524 (LATS2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  NDR family
   26524 (LATS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12.11
AA seq 1088 aa AA seqDB search
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQ
QQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRA
LKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSF
ASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVE
AAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGA
GLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLY
ELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPA
AEGLDAKEEHALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGM
EQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPY
AFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKR
AKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDIL
AEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIE
SVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVG
VILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLG
RNGADDLKAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTK
AWDTLTSPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEASQAESSDLESSDLVDQT
EGCQPVYV
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgaggccaaagacttttcctgccacgacttattctggaaatagccggcagcgactgcaa
gagattcgtgaggggttaaaacagccatccaagtcttcggttcaggggctacccgcagga
ccaaacagtgacacttccctggatgccaaagtcctggggagcaaagatgccaccaggcag
cagcagcagatgagagccaccccaaagttcggaccttatcagaaagccttgagggaaatc
agatattccttgttgccttttgctaatgaatcgggcacctctgcagctgcagaagtgaac
cggcaaatgctgcaggaactggtgaacgcaggatgcgaccaggagatggctggccgagct
ctcaagcagactggcagcaggagcatcgaggccgccctggagtacatcagcaagatgggc
tacctggacccgaggaatgagcagattgtgcgggtcattaagcagacctccccaggaaag
gggctcatgccaaccccagtgacgcggaggcccagcttcgaaggaaccggcgattcgttt
gcgtcctaccaccagctgagcggtaccccctacgagggcccaagcttcggcgctgacggc
cccacggcgctggaggagatgccgcggccgtacgtggactaccttttccccggagtcggc
ccccacgggcccggccaccagcaccagcacccacccaagggctacggtgccagcgtagag
gcagcaggggcacacttcccgctgcagggcgcgcactacgggcggccgcacctgctggtg
cctggggaacccctgggctacggagtgcagcgcagcccctccttccagagcaagacgccg
ccggagaccgggggttacgccagcctgcccacgaagggccagggaggaccgccaggcgcc
ggcctcgctttcccaccccctgccgccgggctctacgtgccgcacccacaccacaagcag
gccggtcccgcggcccaccagctgcatgtgctgggctcccgcagccaggtgttcgccagc
gacagccccccgcagagcctgctcactccctcgcggaacagcctcaacgtggacctgtat
gaattgggcagcacctccgtccagcagtggccggctgccaccctggcccgccgggactcc
ctgcagaagccgggcctggaggcgccgccgcgcgcgcacgtggccttccggcctgactgc
ccagtgcccagcaggaccaactccttcaacagccaccagccgcggcccggtccgcctggc
aaggccgagccctccctgcccgcccccaacaccgtgacggctgtcacggccgcgcacatc
ttgcacccggtgaagagcgtgcgtgtgctgaggccggagccgcagacggctgtggggccc
tcgcaccccgcctgggtgcccgcgcctgccccggcccccgcccccgcccccgccccggct
gcggagggcttggacgccaaggaggagcatgccctggcgctgggcggcgcaggcgccttc
ccgctggacgtggagtacggaggcccagaccggaggtgcccgcctccgccctacccgaag
cacctgctgctgcgcagcaagtcggagcagtacgacctggacagcctgtgcgcaggcatg
gagcagagcctccgtgcgggccccaacgagcccgagggcggcgacaagagccgcaaaagc
gccaagggggacaaaggcggaaaggataaaaagcagattcagacctctcccgttcccgtc
cgcaaaaacagcagagacgaagagaagagagagtcacgcatcaagagctactcgccatac
gcctttaagttcttcatggagcagcacgtggagaatgtcatcaaaacctaccagcagaag
gttaaccggaggctgcagctggagcaagaaatggccaaagctggactctgtgaagctgag
caggagcagatgcggaagatcctctaccagaaagagtctaattacaacaggttaaagagg
gccaagatggacaagtctatgtttgtcaagatcaaaaccctggggatcggtgcctttgga
gaagtgtgccttgcttgtaaggtggacactcacgccctgtacgccatgaagaccctaagg
aaaaaggatgtcctgaaccggaatcaggtggcccacgtcaaggccgagagggacatcctg
gccgaggcagacaatgagtgggtggtcaaactctactactccttccaagacaaagacagc
ctgtactttgtgatggactacatccctggtggggacatgatgagcctgctgatccggatg
gaggtcttccctgagcacctggcccggttctacatcgcagagctgactttggccattgag
agtgtccacaagatgggcttcatccaccgagacatcaagcctgataacattttgatagat
ctggatggtcacattaaactcacagatttcggcctctgcactgggttcaggtggactcac
aattccaaatattaccagaaagggagccatgtcagacaggacagcatggagcccagcgac
ctctgggatgatgtgtctaactgtcggtgtggggacaggctgaagaccctagagcagagg
gcgcggaagcagcaccagaggtgcctggcacattcactggtggggactccaaactacatc
gcacccgaggtgctcctccgcaaagggtacactcaactctgtgactggtggagtgttgga
gtgattctcttcgagatgctggtggggcagccgccctttttggcacctactcccacagaa
acccagctgaaggtgatcaactgggagaacacgctccacattccagcccaggtgaagctg
agccctgaggccagggacctcatcaccaagctgtgctgctccgcagaccaccgcctgggg
cggaatggggccgatgacctgaaggcccaccccttcttcagcgccattgacttctccagt
gacatccggaagcagccagccccctacgttcccaccatcagccaccccatggacacctcg
aatttcgaccccgtagatgaagaaagcccttggaacgatgccagcgaaggtagcaccaag
gcctgggacacactcacctcgcccaataacaagcatcctgagcacgcattttacgaattc
accttccgaaggttctttgatgacaatggctacccctttcgatgcccaaagccttcagga
gcagaagcttcacaggctgagagctcagatttagaaagctctgatctggtggatcagact
gaaggctgccagcctgtgtacgtgtag

DBGET integrated database retrieval system