KEGG   Homo sapiens (human): 26531Help
Entry
26531             CDS       T01001                                 

Gene name
OR11A1, 6M1-18, OR11A2, dJ994E9.6, hs6M1-18
Definition
(RefSeq) olfactory receptor family 11 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26531 (OR11A1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26531 (OR11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26531
NCBI-ProteinID: NP_039225
HGNC: 8176
Ensembl: ENSG00000204694
Vega: OTTHUMG00000031225
Pharos: Q9GZK7(Tdark)
UniProt: Q9GZK7 A0A024RCH9
Position
6p22.1
AA seq 315 aa AA seqDB search
MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKP
MYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMA
YDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYC
DFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFS
TCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQ
ALRKILCIKQTETLD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgtctccacaggaaacgaaactattactgaatttgtcctccttggcttctat
gacatccctgaactgcatttcttgttttttattgtattcactgctgtctatgtcttcatc
atcatagggaatatgctgattattgtagcagtggttagctcccagaggctccacaaaccc
atgtatattttcttggcgaatctgtccttcctggatattctctacacctccgcagtgatg
ccaaaaatgctggagggcttcctgcaagaagcaactatctctgtggctggttgcttgctc
cagttctttatcttcggctctctagccacagctgaatgcttactgctggctgtcatggca
tatgaccgctacctggcaatttgctacccactccactacccactcctgatggggcccaga
cggtacatggggctggtggtcacaacctggctctctggatttgtggtagatggactggtt
gtggccctggtggcccagctgaggttctgtggccccaaccacattgaccagttttactgt
gactttatgcttttcgtgggcctggcttgctcggatcccagagtggctcaggtgacaact
ctcattctgtctgtgttctgcctcactattccttttggactgattctgacatcttatgcc
agaattgtggtggcagtgctgagagttcctgctggggcaagcaggagaagggctttctcc
acatgctcctcccacctagctgtagtgaccacattctatggaacgctcatgatcttttat
gttgcaccctctgctgtccattcccagctcctctccaaggtcttctccctgctctacact
gtggtcacccctctcttcaatcctgtgatctataccatgaggaacaaggaggtgcatcag
gcacttcggaagattctctgtatcaaacaaactgaaacacttgattga

DBGET integrated database retrieval system