KEGG   Homo sapiens (human): 26538Help
Entry
26538             CDS       T01001                                 

Gene name
OR10H2
Definition
(RefSeq) olfactory receptor family 10 subfamily H member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26538 (OR10H2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26538 (OR10H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26538
NCBI-ProteinID: NP_039227
HGNC: 8173
Ensembl: ENSG00000171942
Vega: OTTHUMG00000182389
Pharos: O60403(Tdark)
UniProt: O60403 A0A126GWJ7
Position
19p13.12
AA seq 315 aa AA seqDB search
MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMY
LFLCVLSVSEILYTVAIIPRMLADLLSTQRSIAFLACASQMFFSFSFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSPRGCACLVGCSWAGGSVMGMVVTSAIFQLTFCGSHEIQHFLCH
VPPLLKLACGNNVPAVALGVGLVCIMALLGCFLLILLSYAFIVADILKIPSAEGRNKAFS
TCASHLIVVIVHYGFASVIYLKPKGPHSQEGDTLMATTYAVLTPFLSPIIFSLRNKELKV
AMKRTFLSTLYSSGT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgctggggctaaaccacacctccatgtctgaattcatcctcgtcggcttctctgccttc
ccccacctccaactgatgctcttcctgctgttcctgctgatgtacctgttcacgctgctg
ggcaacctgctcatcatggccaccgtctggagcgagcgcagcctccacacgcccatgtac
ctcttcctgtgcgtcctctcagtctccgagatcctctacaccgtggccatcatcccgcgc
atgctggccgacctgctgtccacccagcgctccatcgccttcctggcctgtgccagtcag
atgttcttctccttcagcttcggcttcacccactccttcctgctcaccgtcatgggctac
gaccgctacgtggccatctgccaccccctgcgctacaacgtgctcatgagcccacggggc
tgcgcctgcctggtgggctgctcctgggctggtggctcggtcatggggatggtggtgacc
tcggccattttccaactgactttctgtggatcccatgagatccagcattttttatgtcat
gtgccacctctgttgaagttggcctgtggaaataatgtaccagctgtggccctgggcgtg
ggcttggtatgtatcatggcactgctgggctgttttctcctcatcctcctctcctatgcc
ttcatcgtggccgacatcttgaagatcccttctgctgaaggtcggaacaaggccttctcc
acctgtgcctctcaccttattgtggtcattgtgcactatggctttgcctctgtcatctac
ctcaagcccaaaggtccccactctcaggagggtgacaccctgatggccaccacctacgca
gtcctcacgcccttcctcagccccatcatcttcagcctcaggaacaaagaactgaaggtt
gccatgaagaggaccttcctcagcacactctattcctcaggcacctga

DBGET integrated database retrieval system