KEGG   Homo sapiens (human): 2657Help
Entry
2657              CDS       T01001                                 

Gene name
GDF1, DORV, DTGA3, RAI
Definition
growth differentiation factor 1
Orthology
K05495  
growth differentiation factor 1/3
Organism
hsa  Homo sapiens (human)
Disease
H00549  
Tetralogy of Fallot
H00918  
Conotruncal heart malformations
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p12
AA seq 372 aa AA seqDB search
MPPPQQGPCGHHLLLLLALLLPSLPLTRAPVPPGPAAALLQALGLRDEPQGAPRLRPVPP
VMWRLFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASA
AGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGP
VLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTL
DPRLCHPLARPRRDAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQC
ALPVALSGSGGPPALNHAVLRALMHAAAPGAADLPCCVPARLSPISVLFFDNSDNVVLRQ
YEDMVVDECGCR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgccgcagcaaggtccctgcggccaccacctcctcctcctcctggccctgctg
ctgccctcgctgcccctgacccgcgcccccgtgcccccaggcccagccgccgccctgctc
caggctctaggactgcgcgatgagccccagggtgcccccaggctccggccggttcccccg
gtcatgtggcgcctgtttcgacgccgggacccccaggagaccaggtctggctcgcggcgg
acgtccccaggggtcaccctgcaaccgtgccacgtggaggagctgggggtcgccggaaac
atcgtgcgccacatcccggaccgcggtgcgcccacccgggcctcggagcctgcctcggcc
gcggggcattgccctgagtggacagtcgtcttcgacctgtcggctgtggaacccgctgag
cgcccgagccgggcccgcctggagctgcgtttcgcggcggcggcggcggcagccccggag
ggcggctgggagctgagcgtggcgcaagcgggccagggcgcgggcgcggaccccgggccg
gtgctgctccgccagttggtgcccgccctggggccgccagtgcgcgcggagctgctgggc
gccgcttgggctcgcaacgcctcatggccgcgcagcctccgcctggcgctggcgctacgc
ccccgggcccctgccgcctgcgcgcgcctggccgaggcctcgctgctgctggtgaccctc
gacccgcgcctgtgccaccccctggcccggccgcggcgcgacgccgaacccgtgttgggc
ggcggccccgggggcgcttgtcgcgcgcggcggctgtacgtgagcttccgcgaggtgggc
tggcaccgctgggtcatcgcgccgcgcggcttcctggccaactactgccagggtcagtgc
gcgctgcccgtcgcgctgtcggggtccggggggccgccggcgctcaaccacgctgtgctg
cgcgcgctcatgcacgcggccgccccgggagccgccgacctgccctgctgcgtgcccgcg
cgcctgtcgcccatctccgtgctcttctttgacaacagcgacaacgtggtgctgcggcag
tatgaggacatggtggtggacgagtgcggctgccgctaa

DBGET integrated database retrieval system