KEGG   Homo sapiens (human): 2657Help
Entry
2657              CDS       T01001                                 

Gene name
GDF1, DORV, DTGA3, RAI
Definition
(RefSeq) growth differentiation factor 1
  KO
K05495  growth differentiation factor 1/3
Organism
hsa  Homo sapiens (human)
Disease
H00549  Tetralogy of Fallot
H00550  Complete transposition of the great arteries
H00632  Heterotaxy
H00918  Double-outlet right ventricle
H01435  Congenital asplenia
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     2657 (GDF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   2657 (GDF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 2657
NCBI-ProteinID: NP_001483
OMIM: 602880
HGNC: 4214
Ensembl: ENSG00000223802
Pharos: P27539(Tbio)
UniProt: P27539 A0A024R7N8
Position
19p13.11
AA seq 372 aa AA seqDB search
MPPPQQGPCGHHLLLLLALLLPSLPLTRAPVPPGPAAALLQALGLRDEPQGAPRLRPVPP
VMWRLFRRRDPQETRSGSRRTSPGVTLQPCHVEELGVAGNIVRHIPDRGAPTRASEPASA
AGHCPEWTVVFDLSAVEPAERPSRARLELRFAAAAAAAPEGGWELSVAQAGQGAGADPGP
VLLRQLVPALGPPVRAELLGAAWARNASWPRSLRLALALRPRAPAACARLAEASLLLVTL
DPRLCHPLARPRRDAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQC
ALPVALSGSGGPPALNHAVLRALMHAAAPGAADLPCCVPARLSPISVLFFDNSDNVVLRQ
YEDMVVDECGCR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgccgcagcaaggtccctgcggccaccacctcctcctcctcctggccctgctg
ctgccctcgctgcccctgacccgcgcccccgtgcccccaggcccagccgccgccctgctc
caggctctaggactgcgcgatgagccccagggtgcccccaggctccggccggttcccccg
gtcatgtggcgcctgtttcgacgccgggacccccaggagaccaggtctggctcgcggcgg
acgtccccaggggtcaccctgcaaccgtgccacgtggaggagctgggggtcgccggaaac
atcgtgcgccacatcccggaccgcggtgcgcccacccgggcctcggagcctgcctcggcc
gcggggcattgccctgagtggacagtcgtcttcgacctgtcggctgtggaacccgctgag
cgcccgagccgggcccgcctggagctgcgtttcgcggcggcggcggcggcagccccggag
ggcggctgggagctgagcgtggcgcaagcgggccagggcgcgggcgcggaccccgggccg
gtgctgctccgccagttggtgcccgccctggggccgccagtgcgcgcggagctgctgggc
gccgcttgggctcgcaacgcctcatggccgcgcagcctccgcctggcgctggcgctacgc
ccccgggcccctgccgcctgcgcgcgcctggccgaggcctcgctgctgctggtgaccctc
gacccgcgcctgtgccaccccctggcccggccgcggcgcgacgccgaacccgtgttgggc
ggcggccccgggggcgcttgtcgcgcgcggcggctgtacgtgagcttccgcgaggtgggc
tggcaccgctgggtcatcgcgccgcgcggcttcctggccaactactgccagggtcagtgc
gcgctgcccgtcgcgctgtcggggtccggggggccgccggcgctcaaccacgctgtgctg
cgcgcgctcatgcacgcggccgccccgggagccgccgacctgccctgctgcgtgcccgcg
cgcctgtcgcccatctccgtgctcttctttgacaacagcgacaacgtggtgctgcggcag
tatgaggacatggtggtggacgagtgcggctgccgctaa

DBGET integrated database retrieval system