KEGG   Homo sapiens (human): 26576Help
Entry
26576             CDS       T01001                                 

Gene name
SRPK3, MSSK-1, MSSK1, STK23
Definition
(RefSeq) SRSF protein kinase 3
  KO
K08832  
serine/threonine-protein kinase SRPK3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     26576 (SRPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  SRPK family [OT]
   26576 (SRPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 567 aa AA seqDB search
MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKD
YCKGGYHPVKIGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETA
VDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNY
QGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLCVGDAYIRRLAAEATEWQQA
GAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKRLLEERLRDLQRLEAMEAATQ
AEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQTSGFSGSLFSP
ASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAH
IVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSA
FLLPMMEYIPEKRASAADCLQHPWLNP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccagcacgggcggtggtggggacagcggcggcagcggcggcagtagcagcagc
tcacaggcctcctgcgggcccgagtcctcgggctccgaactagccctggccacaccggtg
cctcagatgctgcagggccttctgggctccgacgacgaggaacaggaagaccccaaagac
tactgcaagggcggctaccaccctgtgaagatcggcgacgtgttcaatgggcggtaccac
gtggtgcgcaaactgggctggggccacttctccaccgtctggctctgctgggacatccag
cgcaagcgctttgtggccctcaaagtggtgaagagtgcggggcattacacggagacagct
gtggatgagatcaagctcctgaaatgtgtccgggacagcgaccccagtgaccccaaaaga
gagaccattgtccagctcattgatgacttcaggatctcaggagtcaatggagtccatgtg
tgcatggtgctggaggtgctgggccaccagctcctcaaatggatcatcaagtccaactac
cagggcctgcccgtgccctgcgtgaagagcatcgtgaggcaggtgctgcacggcctggac
tacctccacaccaagtgcaagatcatccacacggacatcaagcccgagaacatcttgctg
tgtgtgggggacgcttacatcaggcgcctggctgccgaggccacggagtggcaacaggca
ggggcgccgcccccctcccgctccatagtcagcactgccccccaggaggtcttgcagacc
ggtaagctgtccaaaaacaagaggaagaagatgaggcgcaaacggaaacagcagaagcgg
ctgctggaggagcggctgcgggacctgcagaggctggaggccatggaggctgccacccag
gctgaggactctggcttgagactagacgggggcagcggctccacatcctcttcaggctgt
caccccgggggcgccagagcaggtccctccccagcctcttcctcccccgccccagggggc
ggccgtagcctcagcgcgggctcacagacctcaggcttctccggctccctcttctctcct
gcctcctgctccatcctctccggctcgtccaatcagcgagagaccgggggcctcctgtcg
cctagcacaccattcggtgcctcgaacctcctggtgaaccccctggagccccaaaatgca
gataagatcaagatcaagatcgcagacctgggcaacgcctgctgggtgcacaagcacttc
acggaagacatccagactcggcagtaccgggccgtcgaggtgctgatcggcgccgaatac
ggccccccggcagacatctggagcacagcctgcatggccttcgagctggccactggtgac
tacctgttcgagccgcattctggagaagactacagtcgtgatgaggaccacatcgctcac
atagtggagcttctgggggacatccccccagccttcgccctctcaggccgctattcccgg
gagttcttcaaccggagaggagagctgcggcacatccacaatctcaagcactggggcctg
tacgaggtactcatggaaaagtacgagtggcccctagagcaggccacacagttcagcgcc
tttctgctgcccatgatggagtacatccccgaaaagcgggccagtgccgctgactgcctc
cagcacccctggctcaacccctag

DBGET integrated database retrieval system