KEGG   Homo sapiens (human): 26578Help
Entry
26578             CDS       T01001                                 

Gene name
OSTF1, OSF, SH3P2, bA235O14.1
Definition
(RefSeq) osteoclast stimulating factor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q13-q21.2
AA seq 214 aa AA seqDB search
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKD
IVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMA
TNAACASLLKKKQGTDAVRTLSNAEDYLDDEDSD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagccgccacccaaaccagtcaaaccagggcaagttaaagtcttcagagccctg
tatacgtttgaacccagaactccagatgaattatactttgaggaaggtgatattatctac
attactgacatgagcgataccaattggtggaaaggcacctccaaaggcaggactggacta
attccaagcaactatgtggctgagcaggcagaatccattgacaatccattgcatgaagca
gcaaaaagaggcaacttgagctggttgagagagtgtttggacaacagagtgggtgttaat
ggcttagacaaagctggaagcactgccttatactgggcttgccacgggggccacaaagat
atagtggaaatgctatttactcaaccaaatattgaactgaaccagcagaacaagttggga
gatacagctttgcatgctgctgcctggaagggttatgcagatatcgtccagttgcttctg
gcaaaaggtgctagaacagacttaagaaacattgagaagaagctggccttcgacatggct
accaatgctgcctgtgcatctctcctgaaaaagaaacagggaacagatgcagttcgaaca
ttaagcaatgccgaggactatctcgatgatgaagactcagattaa

DBGET integrated database retrieval system