KEGG   Homo sapiens (human): 2660Help
Entry
2660              CDS       T01001                                 

Gene name
MSTN, GDF8, MSLHP
Definition
(RefSeq) myostatin
  KO
K05497  
growth differentiation factor 8/11
Organism
hsa  Homo sapiens (human)
Drug target
Other: 
Brite
Cytokines [BR:hsa04052]
 TGF-beta family
  Intermediate members
   2660 (MSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.2
AA seq 375 aa AA seqDB search
MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQI
LSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIIT
MPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPM
KDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVT
FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIA
PKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQII
YGKIPAMVVDRCGCS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaactgcaactctgtgtttatatttacctgtttatgctgattgttgctggtcca
gtggatctaaatgagaacagtgagcaaaaagaaaatgtggaaaaagaggggctgtgtaat
gcatgtacttggagacaaaacactaaatcttcaagaatagaagccattaagatacaaatc
ctcagtaaacttcgtctggaaacagctcctaacatcagcaaagatgttataagacaactt
ttacccaaagctcctccactccgggaactgattgatcagtatgatgtccagagggatgac
agcagcgatggctctttggaagatgacgattatcacgctacaacggaaacaatcattacc
atgcctacagagtctgattttctaatgcaagtggatggaaaacccaaatgttgcttcttt
aaatttagctctaaaatacaatacaataaagtagtaaaggcccaactatggatatatttg
agacccgtcgagactcctacaacagtgtttgtgcaaatcctgagactcatcaaacctatg
aaagacggtacaaggtatactggaatccgatctctgaaacttgacatgaacccaggcact
ggtatttggcagagcattgatgtgaagacagtgttgcaaaattggctcaaacaacctgaa
tccaacttaggcattgaaataaaagctttagatgagaatggtcatgatcttgctgtaacc
ttcccaggaccaggagaagatgggctgaatccgtttttagaggtcaaggtaacagacaca
ccaaaaagatccagaagggattttggtcttgactgtgatgagcactcaacagaatcacga
tgctgtcgttaccctctaactgtggattttgaagcttttggatgggattggattatcgct
cctaaaagatataaggccaattactgctctggagagtgtgaatttgtatttttacaaaaa
tatcctcatactcatctggtacaccaagcaaaccccagaggttcagcaggcccttgctgt
actcccacaaagatgtctccaattaatatgctatattttaatggcaaagaacaaataata
tatgggaaaattccagcgatggtagtagaccgctgtgggtgctcatga

DBGET integrated database retrieval system