KEGG   Homo sapiens (human): 2664Help
Entry
2664              CDS       T01001                                 

Gene name
GDI1, 1A, GDIL, MRX41, MRX48, OPHN2, RABGD1A, RABGDIA, XAP-4
Definition
GDP dissociation inhibitor 1
Orthology
K17255  
Rab GDP dissociation inhibitor
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2664 (GDI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 447 aa AA seqDB search
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE
GPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETT
DPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGTAFDFENMKRKQNDVFGEAEQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggaatacgatgtgatcgtgctggggaccggtctcaccgaatgcatcctgtcg
ggcatcatgtctgtgaacgggaagaaggtgctgcacatggaccggaacccctactacggg
ggcgagagctcctccatcacacccctggaggagctgtataagcgttttcagttgctggag
gggccccctgagtcgatgggccgaggccgagactggaatgttgacctgattcccaaattc
ctcatggctaacgggcagctggtaaagatgctactgtatacagaggtgactcgctacctg
gacttcaaggtggtggagggcagctttgtctacaaggggggcaagatctacaaagtgccg
tccactgagactgaggccttggcttccaatctgatgggcatgtttgagaaacggcgcttc
cgcaagttcctggtgtttgtggcaaacttcgatgagaatgaccccaagacctttgagggc
gttgacccccagactaccagcatgcgtgacgtctaccggaagtttgatctgggccaggat
gtcatcgatttcactggccatgccctggcgctctaccgcactgatgactacctggaccag
ccctgccttgagaccgtcaaccgcatcaagttgtacagtgagtccctggcccggtatggc
aagagcccatatttatacccgctctacggcttgggcgagctgccccagggttttgcaaga
ttgagtgccatctatggggggacatatatgctgaacaaacctgtggatgacatcatcatg
gagaacggcaaggtggtgggcgtgaagtctgagggagaggtggcccgctgcaagcagctg
atctgtgaccccagctacatcccggaccgtgtgcggaaggctggccaggttatccgcatc
atctgtatccttagccaccccatcaagaacaccaacgacgccaactcctgccaaataatc
atcccccagaaccaggtcaacaggaagtcagacatctacgtgtgcatgatctcctatgca
cacaacgtggcggcccagggcaagtacatagctattgccagcactactgtggagaccacg
gaccctgaaaaggaggtggagccggctctggagctgttggagcccattgaccagaagttt
gtggctatcagtgacttgtatgagcccattgatgatggttgtgagagccaggtgttctgt
tcctgctcctacgatgccaccacacactttgagacaacctgcaacgacatcaaagacatc
tacaaacgcatggctggcacggcctttgactttgagaacatgaagcgcaaacagaacgac
gtctttggagaagctgagcagtga

DBGET integrated database retrieval system