KEGG   Homo sapiens (human): 26648Help
Entry
26648             CDS       T01001                                 

Gene name
OR7E24, HSHT2, OR19-8, OR7E24P, OR7E24Q
Definition
(RefSeq) olfactory receptor family 7 subfamily E member 24
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26648 (OR7E24)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26648 (OR7E24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 26648
NCBI-ProteinID: NP_001073404
HGNC: 8396
Ensembl: ENSG00000237521
Vega: OTTHUMG00000179938
Pharos: Q6IFN5(Tdark)
UniProt: Q6IFN5
Position
19p13.2
AA seq 339 aa AA seqDB search
MSYFPILFFFFLKRCPSYTEPQNLTGVSEFLLLGLSEDPELQPVLAGLFLSMYLVTVLGN
LLIILAVSSDSHLHTPMYFFLSNLSLADIGFTSTTVPKMIVDMQTHSRVISYEGCLTQMS
FFVLFACMDDMLLSVMAYDRFVAICHPLHYRIIMNPRLCGFLILLSFFISLLDSQLHNLI
MLQLTCFKDVDISNFFCDPSQLLHLRCSDTFINEMVIYFMGAIFGCLPISGILFSYYKIV
SPILRVPTSDGKYKAFSTCGSHLAVVCLFYGTGLVGYLSSAVLPSPRKSMVASVMYTVVT
PMLNPFIYSLRNKDIQSALCRLHGRIIKSHHLHPFCYMG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtcctattttccaattctctttttttttttcctcaaaaggtgtccgagctacacagag
ccacagaatctcacaggtgtctcagaattcctcctcctgggactctcagaggatccagaa
ctgcagccggtcctcgctgggctgttcctgtccatgtacctggtcacggtgctggggaac
ctgctcatcatcctggctgtcagctctgactcccacctccacacccccatgtacttcttc
ctctccaacctgtccttggctgacatcggtttcacctccaccacggtccccaagatgatt
gtggacatgcaaactcacagcagagtcatctcctatgaaggctgcctgactcagatgtct
ttttttgtcctttttgcatgtatggatgacatgctcctgagtgtgatggcctatgaccgg
tttgtggccatctgtcaccccctgcactaccgaatcatcatgaacccacgcctctgtggc
ttcttaatcttgttgtctttttttattagtcttttggactcccagttgcacaatttgatt
atgttacagctcacctgcttcaaggatgtggacatttctaatttcttctgtgacccttct
caactcctccaccttaggtgttccgacaccttcatcaatgaaatggtcatatatttcatg
ggtgccatatttggctgtctccctatctcagggatccttttctcttactataaaattgtt
tcccccattctgagagttccaacatcagatgggaagtataaagccttctccacctgtggc
tctcacctggcagttgtttgcttattttatggaacagggcttgtagggtacctcagttca
gctgtgttaccatcccccaggaagagtatggtggcttcagtgatgtacactgtggtcacc
cccatgctgaaccccttcatctacagcctgaggaacaaggacattcaaagtgccctgtgc
aggctgcatggcagaatcatcaaatctcatcatctccatcctttttgttatatgggatag

DBGET integrated database retrieval system