KEGG   Homo sapiens (human): 26659Help
Entry
26659             CDS       T01001                                 

Gene name
OR7A5, HTPCR2
Definition
olfactory receptor, family 7, subfamily A, member 5
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.1
AA seq 319 aa AA seqDB search
MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAY
DRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCE
LNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFST
CASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRA
LGIHLLWGTMKGQFFKKCP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaggaaatgatacacaaatttcagaatttcttcttctgggattttcacaagaa
cctggactgcaacccttcctctttgggctgttcctgtccatgtacctggtcactgtgctc
gggaacctgctcatcatcctggccacaatctcagactcccacctccacacccccatgtac
ttcttcctctccaacctgtcctttgctgacatttgtgttacttccaccaccattccaaaa
atgctgatgaacatccagacacagaacaaagtcatcacctacatagcctgcctcatgcag
atgtattttttcatactctttgctggatttgaaaacttcctcctgtccgtgatggcctat
gaccggtttgtggccatctgtcaccccctgcactacatggtcattatgaaccctcacctc
tgtggactgctggttctagcatcctggaccatgagtgctctgtattccttgctacaaatc
ttaatggtagtacggctgtccttctgcacagccttagaaatcccccactttttctgtgaa
cttaatcaggtcatccaacttgcttgttctgatagctttcttaatcacatggtgatatat
tttacagttgcgctgctgggtggaggtcccctgactgggatcctttactcttactctaag
ataatttcttccatacatgcaatctcatcagctcaggggaagtacaaggcattttccacc
tgtgcatctcacctctcagttgtctccttattttatggtgcaatcctaggggtgtacctt
agttctgctgccacccgcaactcacactcaagtgcaacagcctcagtgatgtacactgtg
gtcacccccatgctgaacccctttatctatagtctgaggaataaagacataaagagggct
ctgggaatacatttgttgtggggaacaatgaaagggcaatttttcaagaagtgcccatga

DBGET integrated database retrieval system