KEGG   Homo sapiens (human): 26682Help
Entry
26682             CDS       T01001                                 

Gene name
OR4F4, OLA-7501, OR4F18
Definition
olfactory receptor, family 4, subfamily F, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26682 (OR4F4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26682 (OR4F4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 305 aa AA seqDB search
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAH
SSVKF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgaattcatttttctgggtctctctgattctcaggaactccagaccttccta
tttatgttgttttttgtattctatggaggaatcgtgtttggaaaccttcttattgtcata
acagtggtatctgactcccaccttcactctcccatgtacttcctgctagccaacctctca
ctcattgatctgtctctgtcttcagtcacagcccccaagatgattactgactttttcagc
cagcgcaaagtcatctctttcaagggctgccttgttcagatatttctccttcacttcttt
ggtgggagtgagatggtgatcctcatagccatgggctttgacagatatatagcaatatgc
aaacccctacactacactacaattatgtgtggcaacgcatgtgtcggcattatggctgtc
gcatggggaattggctttctccattcggtgagccagttggcctttgccgtgcacttaccc
ttctgtggtcccaatgaggtcgatagtttttattgtgaccttcctagggtaatcaaactt
gcctgtacagatacctacaggctagatattatggtcattgctaacagtggtgtgctcact
gtgtgttcttttgttcttctaatcatctcatacactatcatcctaatgaccatccagcat
tgccctttagataagtcgtccaaagctctgtccactttgactgctcacattacagtagtt
cttttgttctttggaccatgtgtctttatttatgcctggccattccccatcaagtcatta
gataaattccttgctgtattttattctgtgatcacccctctcttgaacccaattatatac
acactgaggaacaaagacatgaagacggcaataagacggctgagaaaatgggatgcacat
tctagtgtaaagttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system