KEGG   Homo sapiens (human): 26683Help
Entry
26683             CDS       T01001                                 

Gene name
OR4F3
Definition
(RefSeq) olfactory receptor family 4 subfamily F member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26683 (OR4F3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26683 (OR4F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF456
Motif
Other DBs
NCBI-GeneID: 26683
NCBI-ProteinID: NP_001005224
HGNC: 8300
Ensembl: ENSG00000230178
Vega: OTTHUMG00000162081
UniProt: Q6IEY1 A0A126GV92
Position
5q35.3
AA seq 312 aa AA seqDB search
MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY
FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF
DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD
LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL
SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR
VCKQLVIYKRIS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatggagagaatcactcagtggtatctgagtttttgtttctgggactcactcattca
tgggagatccagctcctcctcctagtgttttcctctgtgctctatgtggcaagcattact
ggaaacatcctcattgtgttttctgtgaccactgaccctcacttacactcccccatgtac
tttctactggccagtctctccttcattgacttaggagcctgctctgtcacttctcccaag
atgatttatgacctgttcagaaagcgcaaagtcatctcctttggaggctgcatcgctcaa
atcttcttcatccacgtcgttggtggtgtggagatggtgctgctcatagccatggccttt
gacagatatgtggccctatgtaagcccctccactatctgaccattatgagcccaagaatg
tgcctttcatttctggctgttgcctggacccttggtgtcagtcactccctgttccaactg
gcatttcttgttaatttagccttctgtggccctaatgtgttggacagcttctactgtgac
cttcctcggcttctcagactagcctgtaccgacacctacagattgcagttcatggtcact
gttaacagtgggtttatctgtgtgggtactttcttcatacttctaatctcctacgtcttc
atcctgtttactgtttggaaacattcctcaggtggttcatccaaggccctttccactctt
tcagctcacagcacagtggtccttttgttctttggtccacccatgtttgtgtatacacgg
ccacaccctaattcacagatggacaagtttctggctatttttgatgcagttctcactcct
tttctgaatccagttgtctatacattcaggaataaggagatgaaggcagcaataaagaga
gtatgcaaacagctagtgatttacaagaggatctcataa

DBGET integrated database retrieval system