KEGG   Homo sapiens (human): 26686Help
Entry
26686             CDS       T01001                                 

Gene name
OR4E2, OR14-42
Definition
(RefSeq) olfactory receptor family 4 subfamily E member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26686 (OR4E2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26686 (OR4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26686
NCBI-ProteinID: NP_001001912
HGNC: 8297
Ensembl: ENSG00000221977
Vega: OTTHUMG00000168979
UniProt: A0A126GVR8
Position
14q11.2
AA seq 313 aa AA seqDB search
MDSLNQTRVTEFVFLGLTDNRVLEMLFFMAFSAIYMLTLSGNILIIIATVFTPSLHTPMY
FFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCITQLFFLHLFACAEIFLLIIMAY
DRYVAICTPLHYPNVMNMRVCIQLVFALWLGGTVHSLGQTFLTIRLPYCGPNIIDSYFCD
VPLVIKLACTDTYLTGILIVTNSGTISLSCFLAVVTSYMVILVSLRKHSAEGRRKALSTC
SAHFMVVALFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQ
LRQRQVFFTKSYT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggacagtctaaaccaaacaagagtgactgaatttgtcttcttgggactcactgataac
cgggtgctggaaatgctgtttttcatggcattctcagccatttatatgctaacgctttcg
gggaacattctcatcatcattgccacagtctttactccaagtctccatacccccatgtat
ttcttcctgagcaatctgtcctttattgacatctgccactcatctgtcactgtgcctaag
atgttggagggtttgcttttagaaagaaagaccatttcctttgacaactgcatcacacag
ctcttcttcctacatctctttgcctgtgccgagatctttctgctgatcattatggcgtat
gatcgttacgtggctatctgcactccactccactaccccaatgtgatgaacatgagagtc
tgtatacagcttgtctttgctctctggttggggggtactgttcactcactagggcagacc
ttcttgactattcgtctaccttactgtggccccaacattattgacagctacttctgtgat
gtgcctcttgttatcaagctggcctgcacagatacatacctcacaggaatactgattgtg
accaatagtggaaccatctccctctcctgtttcttggccgtggtcacctcctatatggtc
atcctggtttctcttcgaaaacactcagctgaagggcgccggaaagccctgtctacctgc
tcggcccacttcatggtggttgccctcttctttgggccatgtatcttcatctatactcgg
ccagacaccagcttctccattgacaaggtggtgtctgtcttctacacagtggtcacccct
ttgctgaatcccttcatttacaccttgaggaatgaggaggtaaaaagtgccatgaagcag
ctcaggcagagacaagtttttttcacgaaatcatatacataa

DBGET integrated database retrieval system