KEGG   Homo sapiens (human): 26689Help
Entry
26689             CDS       T01001                                 

Gene name
OR4D1, OR17-23, OR4D3, OR4D4P, TPCR16
Definition
(RefSeq) olfactory receptor family 4 subfamily D member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26689 (OR4D1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26689 (OR4D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 26689
NCBI-ProteinID: NP_036506
HGNC: 8293
Ensembl: ENSG00000141194
Vega: OTTHUMG00000178799
Pharos: Q15615(Tdark)
UniProt: Q15615
Position
17q22
AA seq 310 aa AA seqDB search
MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMY
FLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY
DRYIAISQPLRYVTIMNTQLCVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCD
VPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLISYTVILVMLRSHSGKARRKAASTC
TTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTPMLNPMIYTLRNQDMKAAMRR
LGKCLVICRE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaaccacagaacaccacacaggtatcaatgtttgtcctcttagggttttcacagacc
caagagctccagaaattcctgttccttctgttcctgttagtctatgttaccaccattgtg
ggaaacctccttatcatggtcacagtgacttttgactgccggctccacacacccatgtat
tttctgctccgaaatctagctctcatagacctctgctattccacagtcacctctccaaag
atgctggtggacttcctccatgagaccaagacgatctcctaccagggctgcatggcccag
atcttcttcttccaccttttgggaggtgggactgtcttttttctctcagtcatggcctat
gaccgctacatagccatctcccagcccctccggtatgtcaccatcatgaacactcaattg
tgtgtgggcctggtagtagccgcctgggtggggggctttgtccactccattgtccaactg
gctctgatacttccactgcccttctgtggccccaatatcctagataacttctactgtgat
gttccccaagtactgagacttgcctgcactgatacctccctcctggagttcctcatgatc
tccaacagtgggctgctagttatcatctggttcctcctccttctgatctcttatactgtc
atcctggtgatgctgaggtcccactcgggaaaggcaaggaggaaggcagcttccacctgc
accacccacatcatcgtggtgtccatgatcttcattccctgtatctatatctatacctgg
cccttcaccccattcctcatggacaaggctgtgtccatcagctacacagtcatgaccccc
atgctcaaccccatgatctacaccctgagaaaccaggacatgaaagcagccatgaggaga
ttaggcaagtgcctagtaatttgcagggagtaa

DBGET integrated database retrieval system