KEGG   Homo sapiens (human): 26716Help
Entry
26716             CDS       T01001                                 

Gene name
OR2H1, 6M1-16, HS6M1-16, OLFR42A-9004-14, OR2H6, OR2H8, OR6-2, dJ994E9.4
Definition
olfactory receptor, family 2, subfamily H, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26716 (OR2H1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26716 (OR2H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.32
AA seq 316 aa AA seqDB search
MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFF
LSDLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDR
YVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQQIDDFLCEVP
SLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQAVLRINSATAWRKAFGTCS
SHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALR
RLLGKERDSRESWRAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggttaaccaaagctcccccatgggcttcctccttctgggcttctctgaacacccagca
ctggaaaggactctctttgtggttgtcttcacttcctacctcttgaccctggtgggcaac
acactcatcatcctgctgtctgtactgtaccccaggctccactctccaatgtactttttc
ctctctgacctctccttcttggacctctgctttaccacaagttgtgtcccccagatgctg
gtcaacctctggggcccaaagaagaccatcagcttcctgggatgctctgtccagctcttc
atcttcctgtccctggggaccactgagtgcatcctcctgacagtgatggcctttgaccga
tacgtggctgtctgccagcccctccactatgccaccatcatccacccccgcctgtgctgg
cagctggcatctgtggcctgggttatgagtctggttcaatcgatagtccagacaccatcc
accctccacttgcccttctgtccccaccagcagatagatgactttttatgtgaggtccca
tctctgattcgactctcctgtggagatacctcctacaatgaaatccagttggctgtgtcc
agtgtcatcttcgtggttgtgcctctcagcctcatccttgcctcttatggagccactgcc
caggcagtgctgaggattaactctgccacagcatggagaaaggcctttgggacctgctcc
tcccatctcactgtggtcaccctcttctacagctcagtcattgctgtctacctccagccc
aaaaatccgtatgcccaagggaggggcaagttctttggtctcttctatgcagtgggcact
ccttcacttaaccctctcgtatacaccctgaggaacaaggagataaagcgagcactcagg
aggttactagggaaggaaagagactccagggaaagctggagagctgcttaa

DBGET integrated database retrieval system