KEGG   Homo sapiens (human): 26740Help
Entry
26740             CDS       T01001                                 

Gene name
OR1J2, HG152, HSA5, OR1J3, OR1J5, OR9-19, OST044
Definition
olfactory receptor, family 1, subfamily J, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26740 (OR1J2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26740 (OR1J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 313 aa AA seqDB search
MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY
FFLSHLALTDISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAY
DRYVAICHPLHYTVIMREELCVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCD
LAALLKLSCSDIFLNELVMFTVGVVVITLPFMCILVSYGYIGATILRVPSTKGIHKALST
CGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTVVTPMLNPFIYSLRNRDMKEA
LGKLFSRATFFSW
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgagaaccagagcagcgtgtccgagttcctccttctgggcctccccatccgg
ccagagcagcaggctgtgttcttcaccctgttcctgggcatgtacctgaccacggtgctg
gggaacctgctcatcatgctgctcatccagctggactctcaccttcacacccccatgtac
ttcttcctcagccacttggctctcactgacatctccttttcatctgtcactgtccctaag
atgctgatggacatgcggactaagtacaaatcgatcctctatgaggaatgcatttctcag
atgtatttttttatattttttactgacctggacagcttccttattacatcaatggcatat
gaccgatatgttgccatatgtcaccctctccactacactgtcatcatgagggaagagctc
tgtgtcttcttagtggctgtatcttggattctgtcttgtgccagctccctctctcacacc
cttctcctgacccggctgtctttctgtgctgcgaacaccatcccccatgtcttctgtgac
cttgctgccctgctcaagctgtcctgctcagatatcttcctcaatgagctggtcatgttc
acagtaggggtggtggtcattaccctgccattcatgtgtatcctggtatcatatggctac
attggggccaccatcctgagggtcccttcaaccaaagggatccacaaagcattgtccaca
tgtggctcccatctctctgtggtgtctctctattatgggtcaatatttggccagtacctt
ttcccgactgtaagcagttctattgacaaggatgtcattgtggctctcatgtacacggtg
gtcacacccatgttgaacccctttatctacagccttaggaacagggacatgaaagaggcc
cttgggaaactcttcagtagagcaacatttttctcttggtga

DBGET integrated database retrieval system