KEGG   Homo sapiens (human): 268Help
Entry
268               CDS       T01001                                 

Gene name
AMH, MIF, MIS
Definition
anti-Mullerian hormone
Orthology
K04665  
anti-mullerian hormone
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway
Disease
H00609  
46,XY disorders of sex development (Other)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    268 (AMH)
   04390 Hippo signaling pathway
    268 (AMH)
   04024 cAMP signaling pathway
    268 (AMH)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    268 (AMH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 560 aa AA seqDB search
MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALG
GDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGA
WLRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAG
LPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHR
CFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRA
LRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDP
APLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIP
ETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLS
EERISAHHVPNMVATECGCR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacctgcctctcaccagcctggccctagtgctgtctgccctgggggctctgctg
gggactgaggccctcagagcagaggagccagctgtgggcaccagtggcctcatcttccga
gaagacttggactggcctccaggcagcccacaagagcctctgtgcctggtggcactgggc
ggggacagcaatggcagcagctcccccctgcgggtggtgggggctctaagcgcctatgag
caggccttcctgggggccgtgcagagggcccgctggggcccccgagacctggccaccttc
ggggtctgcaacaccggtgacaggcaggctgccttgccctctctacggcggctgggggcc
tggctgcgggaccctggggggcagcgcctggtggtcctacacctggaggaagtgacctgg
gagccaacaccctcgctgaggttccaggagcccccgcctggaggagctggccccccagag
ctggcgctgctggtgctgtaccctgggcctggccctgaggtcactgtgacgagggctggg
ctgccgggtgcccagagcctctgcccctcccgagacacccgctacctggtgttagcggtg
gaccgccctgcgggggcctggcgcggctccgggctggccttgaccctgcagccccgcgga
gaggactcccggctgagtaccgcccggctgcaggcactgctgttcggcgacgaccaccgc
tgcttcacacggatgaccccggccctgctcctgctgccgcggtccgagcccgcgccgctg
cctgcgcacggccagctggacaccgtgcccttcccgccgcccaggccatccgcggaactc
gaggagtcgccacccagcgcagaccccttcctggagacgctcacgcgcctggtgcgggcg
ctgcgggtccccccggcccgggcctccgcgccgcgcctggccctggatccggacgcgctg
gccggcttcccgcagggcctagtcaacctgtcggaccccgcggcgctggagcgcctactc
gacggcgaggagccgctgctgctgctgctgaggcccactgcggccaccaccggggatcct
gcgcccctgcacgaccccacgtcggcgccgtgggccacggccctggcgcgccgcgtggct
gctgaactgcaagcggcggctgccgagctgcgaagcctcccgggtctgcctccggccaca
gccccgctgctggcgcgcctgctcgcgctctgcccaggtggccccggcggcctcggcgat
cccctgcgagcgctgctgctcctgaaggcgctgcagggcctgcgcgtggagtggcgcggg
cgggatccgcgcgggccgggtcgggcacagcgcagcgcgggggccaccgccgccgacggg
ccgtgcgcgctgcgcgagctcagcgtagacctccgcgccgagcgctccgtactcatcccc
gagacctaccaggccaacaattgccagggcgtgtgcggctggcctcagtccgaccgcaac
ccgcgctacggcaaccacgtggtgctgctgctgaagatgcaggcccgtggggccgccctg
gcgcgcccaccctgctgcgtgcccaccgcctacgcgggcaagctgctcatcagcctgtcg
gaggagcgcatcagcgcgcaccacgtgcccaacatggtggccaccgagtgtggctgccgg
tga

DBGET integrated database retrieval system