KEGG   Homo sapiens (human): 26873Help
Entry
26873             CDS       T01001                                 

Gene name
OPLAH, 5-Opase, OPLA, OPLAHD
Definition
5-oxoprolinase (ATP-hydrolysing) (EC:3.5.2.9)
Orthology
K01469  
5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    26873 (OPLAH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     26873 (OPLAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
8q24.3
AA seq 1288 aa AA seqDB search
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAG
MLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFD
LAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDLLEVQQPVDLGALRGKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSAT
TYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYA
PETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATA
RSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGLRLEDAPKAQTGPPRVD
KMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICIS
VGAEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEA
LRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEV
FGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRA
FRPYGLHGGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
PPPGSPPQALAFPEHGSVYEYRRAQEAV
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccccgagggccgcttccactttgccatcgaccgtgggggtaccttcacagac
gtctttgcccagtgcccaggggggcacgtgcgggtcttaaaactgctctcagaggaccct
gccaactatgcggacgcgccaaccgaaggcatccgccgcatcctggagcaggaggccggc
atgctcctgccccgggaccagccgctggactccagtcatatcgccagcatccgcatgggc
accacagtggccaccaacgcactgctggagcggaagggggagcgggtggcgctgctggtg
acacgtggcttccgagacctgctgcacattggcacccaagcccgtggggacctctttgac
ctggccgtgcccatgcctgaggtgctgtatgaagaggtgctggaggtggacgaacgcgtg
gtgctgcaccgtggagaggcgggcaccgggacgcctgtgaaaggccgcacgggggacctg
ctggaagtgcagcagcctgtggacctgggggccctgcgtgggaagctggaggggctgcta
tctcgaggcatccgcagcctggctgtggtgctcatgcactcgtacacgtgggcccagcat
gagcagcaggtgggtgtgctggcccgggagctgggcttcacgcacgtgtcactgtcctcg
gaggccatgcccatggtgcgcatcgtccctcgggggcacacggcctgtgccgacgcctac
ctcacgcccgccatccagcgctacgtgcagggcttctgccgtggcttccagggccaactc
aaggatgtgcaggtgttgttcatgcgctccgatggcggcctggcgcccatggacaccttc
agcggctccagtgctgtgctctcgggcccggccggcggcgtggtgggctactcagccacc
acctaccagcaggagggtggccagcctgtcatcggctttgacatgggaggcacgtccacg
gatgtgagccgctatgctggggaattcgagcacgtcttcgaggccagcacagctggcgtc
accctccaggccccgcagctggacatcaacaccgtggcagcgggagggggttcccgcctc
ttcttcaggtctggcctctttgtggttgggcccgagtcagcaggagcccacccaggaccc
gcctgctaccgcaaagggggccctgtgacagtgacggatgctaatctggtcctgggtcgc
ctgctgcctgcctccttcccctgcatttttgggccgggagagaaccaaccactttcccct
gaggcctcccgcaaagccctggaggctgtggccactgaggtcaacagcttcctgaccaac
gggccctgcccggcctccccgctgagcctggaggaggtggccatggggttcgtgcgcgtg
gccaacgaggccatgtgccggcccatccgtgcactcacgcaggcaagaggccatgacccc
tcagcccatgtgctggcctgctttgggggagctggtgggcagcatgcatgtgccatcgcc
cgggccctgggcatggacacggtgcacatccacaggcacagtgggctgctgtcggccctg
gggctggccctggctgacgtggtgcatgaggcacaggaaccctgctccctgctctacgcg
cctgagaccttcgtgcagctggaccagaggctgagccgcctggaggagcagtgtgtggat
gctctgcaggcccagggcttccccaggtcccagatcagcactgagagcttcctgcacctg
cgctaccagggcacggactgtgctctgatggtgtctgcccaccagcacccagccacagcc
cgctcgccccgtgcgggggacttcggggcagcctttgtggagcggtacatgagggagttt
ggctttgtcatacctgagcggccggtggtcgtggacgatgtgcgagtgcggggcaccggc
cgcagtggtcttcgcctcgaggatgcccccaaagcccagaccgggcctccccgggtggac
aagatgacccagtgctactttgaggggggctaccaggagacccctgtgtacctgctggca
gagctgggctatgggcacaagctccatgggccctgcctcatcatcgacagtaacagcacc
atcctggtggagccaggttgccaggcagaggtgaccaagacaggggacatctgcatctcc
gtgggggccgaagtccccggcacagtgggcccccagctggaccctatccagctgtccatc
ttctcacaccgcttcatgagcattgctgagcagatgggccgcatcctgcagcgcacagcc
atctccaccaacatcaaggagcgtctggacttctcctgtgccctctttgggcccgatggg
gggctggtgtccaatgccccccacatccctgtgcacctgggtgccatgcaggagacggtg
cagttccagattcagcacctgggggccgatctccaccctggcgacgtgctactgagcaac
catcccagtgccgggggcagccacctgccagacctgactgttatcacaccggtgttttgg
ccgggtcagacgcggcctgtgttctatgtggccagccgagggcaccacgcagacatcggg
ggcatcacaccaggctccatgcccccccactccaccatgctgcaacaggagggtgccgtc
tttctgtccttcaaacttgtccaggggggcgtcttccaggaggaggcggtgacggaggcc
ctgcgggcgccaggcaaggtccccaactgcagcggaaccagaaacctgcacgacaacctg
tcggacctccgtgcccaggtggcagccaaccagaagggcatccagctggtgggggagctc
attgggcagtacggcctggacgtggtgcaggcctacatgggccatattcaggcaaacgct
gagctggccgtgcgagacatgttgcgtgcctttggaacctcccggcaggcccggggcctg
cccctggaggtgtcctcggaagaccacatggacgacggttcccccatccgcctccgtgtg
cagatcagcctgagtcagggcagcgccgtgtttgacttcagcggcactgggccggaggtg
tttggtaatctcaacgcaccgcgggccgtaaccctgtccgccctcatctactgcctgcgc
tgtctggtgggccgcgacatcccactcaaccagggctgcctggcgccagtgcgcgtggtc
attccccgaggctccatcctggacccgtcgcccgaggcggcggtggtgggcggcaacgtg
ctcacgtcgcagcgcgtggtggatgtcatcctgggggcctttggggcctgcgccgcctcc
cagggctgcatgaacaacgtgaccctgggcaacgcccacatgggctactacgagacggtg
gcgggcggcgcgggcgcgggtcccagctggcacgggcgcagcggtgtgcacagccacatg
accaacacacgcatcaccgaccctgagatcctggagagccggtacccggtcatcctgcgc
cgcttcgagctgcggcggggctcggggggcagaggccgcttccgaggcggcgacggcgtc
acccgcgagctgctctttcgtgaggaggcgctgctgtcagtgctgaccgagcgccgcgcc
ttccggccatacgggctccacgggggcgagcctggcgcccgcggcctaaacctgctgatc
cgcaaaaacggccggacggtgaatctgggcggcaagacgtcggtgaccgtgtaccccggg
gatgtgttctgtctccacacgcccggcggcggtggctatggggacccggaggaccccgcc
ccaccgccggggtcgcccccgcaagcactggcctttcccgagcacggcagcgtctatgag
tatcgccgggcccaggaggccgtgtga

DBGET integrated database retrieval system